Citrus Sinensis ID: 025100

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MLRVAARRLLSPSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
cHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccEEEcccccccccEEEEEEccEEEEEEEccHHHHHHHccccccccccccccccccccccEEEEEcccccccccccccccccccEEcccccccccccccEEccccccccccccEEEccccEEEEc
cccHHccccccHHcHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHcccccEEEEEEccEEEEEEEccHHHHHHHHcccHHHccccccHHHccccccEEEEEccccccccccEEcccccEEEEEccccEEEEccccEEEcccccccccccEEEccccEEEEc
MLRVAArrllspssssslrpmassrniingagsssssnddfrsngfygsgylgpqfqlpcrgvpatvaavknptskivydeynheryppgdpskrAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEvdlssiepgstvtvkwrgkpvfirRRTEediklansvdlgslrdpqqdaervknpeWLVVVGVCThlgciplpnagdfggwfcpchgshydisgrirkgpapynlevpsysfldenkmlig
mlrvaarrllspssssslrpmaSSRNIIngagsssssndDFRSNGFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEvdlssiepgstvtvkwrgkpvfirrrteediklansvdlgslrdpqqdaervknpEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGpapynlevpsysfldenkmlig
MLRVaarrllspssssslrpmassrniingagsssssnddfrsngfYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
********************************************GFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERY******KRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLA*******************NPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFL********
*************************************************************************************************AYFVLTGGRFVYASLIRLLILKFVLSMSASK***AM*SLEVDLSSIEPGSTVTVKWRGKPVFIRRRTE*************LRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
********************MASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
****************************************************************************************PGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRVAARRLLSPSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
P49727273 Cytochrome b-c1 complex s N/A no 0.988 0.934 0.728 1e-109
P49729258 Cytochrome b-c1 complex s N/A no 0.759 0.759 0.933 1e-108
P51133268 Cytochrome b-c1 complex s N/A no 0.841 0.809 0.850 1e-108
P51132272 Cytochrome b-c1 complex s N/A no 0.759 0.720 0.928 1e-108
P37841265 Cytochrome b-c1 complex s N/A no 0.821 0.8 0.873 1e-108
P51135268 Cytochrome b-c1 complex s N/A no 0.841 0.809 0.846 1e-108
P51134236 Cytochrome b-c1 complex s N/A no 0.759 0.830 0.928 1e-107
P07056231 Cytochrome b-c1 complex s N/A no 0.627 0.701 0.611 5e-58
P08067215 Cytochrome b-c1 complex s yes no 0.631 0.758 0.579 3e-57
Q69BJ7274 Cytochrome b-c1 complex s N/A no 0.643 0.605 0.530 6e-55
>sp|P49727|UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays PE=2 SV=1 Back     alignment and function desciption
 Score =  396 bits (1017), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/276 (72%), Positives = 225/276 (81%), Gaps = 21/276 (7%)

Query: 1   MLRVAARRLLSPSSSSSLRPMAS-SRNIINGAGSSSSSNDDFR----------------S 43
           MLRVA RRL   SSS S RP A+ +R  + GAG     +D  R                S
Sbjct: 1   MLRVAGRRL---SSSLSWRPAAAVARGPLAGAGVPDRDDDSARGRSQPRFSIDSPFFVAS 57

Query: 44  NGFYGSGYLGPQFQ-LPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVL 102
            GF  +  + P+ Q      +PATVAAVKNP  K+VYDEYNHERYPPGDPSKRAFAYFVL
Sbjct: 58  RGFSSTETVVPRNQDAGLADLPATVAAVKNPNPKVVYDEYNHERYPPGDPSKRAFAYFVL 117

Query: 103 TGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRR 162
           +GGRF+YASL+RLL+LKFVLSMSASKDVLA+ASLEVDLSSIEPG+TVTVKWRGKPVFIRR
Sbjct: 118 SGGRFIYASLLRLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRR 177

Query: 163 RTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPC 222
           RTE+DIKLANSVD+ SLR P+QDAERVKNPEWLVV+GVCTHLGCIPLPNAGDFGGWFCPC
Sbjct: 178 RTEDDIKLANSVDVASLRHPEQDAERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPC 237

Query: 223 HGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG 258
           HGSHYDISGRIRKGPAP+NLEVP+YSFL+ENK+L+G
Sbjct: 238 HGSHYDISGRIRKGPAPFNLEVPTYSFLEENKLLVG 273
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Zea mays (taxid: 4577)
EC: 1EC: .EC: 1EC: 0EC: .EC: 2EC: .EC: 2
>sp|P49729|UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P51133|UCRI3_TOBAC Cytochrome b-c1 complex subunit Rieske-3, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P51132|UCRI2_TOBAC Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P37841|UCRI_SOLTU Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Solanum tuberosum GN=FES1 PE=1 SV=1 Back     alignment and function description
>sp|P51135|UCRI5_TOBAC Cytochrome b-c1 complex subunit Rieske-5, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P51134|UCRI4_TOBAC Cytochrome b-c1 complex subunit Rieske-4, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P07056|UCRI_NEUCR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06606 PE=3 SV=1 Back     alignment and function description
>sp|P08067|UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIP1 PE=1 SV=1 Back     alignment and function description
>sp|Q69BJ7|UCRI_SAISC Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saimiri sciureus GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
449452028274 PREDICTED: cytochrome b-c1 complex subun 0.926 0.872 0.757 1e-110
255543531280 ubiquinol-cytochrome C reductase iron-su 0.988 0.910 0.752 1e-110
449452030274 PREDICTED: cytochrome b-c1 complex subun 0.895 0.843 0.766 1e-108
357508447273 Ubiquinol-cytochrome c reductase iron-su 0.984 0.930 0.740 1e-108
224053573275 predicted protein [Populus trichocarpa] 0.972 0.912 0.741 1e-108
162458481273 cytochrome b-c1 complex subunit Rieske, 0.988 0.934 0.728 1e-108
388516897273 unknown [Medicago truncatula] 0.984 0.930 0.740 1e-108
194691146273 unknown [Zea mays] gi|413918191|gb|AFW58 0.988 0.934 0.728 1e-108
388498708273 unknown [Lotus japonicus] 0.984 0.930 0.729 1e-108
212723608273 ubiquinol-cytochrome c reductase iron-su 0.988 0.934 0.724 1e-107
>gi|449452028|ref|XP_004143762.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] gi|449516924|ref|XP_004165496.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/264 (75%), Positives = 225/264 (85%), Gaps = 25/264 (9%)

Query: 12  PSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRG--------- 62
           P+ +SSL P+  S NII+     S+ ++DFRS GF+ +  + P F    RG         
Sbjct: 19  PTIASSL-PL--SHNIID-----STDSNDFRSAGFFHTFPIRPHFDRNSRGFASDALTST 70

Query: 63  --------VPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIR 114
                   VPAT+AAVKNPTSKIVYDEYNHER+PPGDPSKRAFAYFVL+GGRFVYASLIR
Sbjct: 71  KENNLVPDVPATIAAVKNPTSKIVYDEYNHERFPPGDPSKRAFAYFVLSGGRFVYASLIR 130

Query: 115 LLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSV 174
           LL+LKFVLSMSASKDVLA+ASLEVDLSSIEPG+TVTVKWRGKPVFIRRRTEEDIKLANSV
Sbjct: 131 LLVLKFVLSMSASKDVLALASLEVDLSSIEPGATVTVKWRGKPVFIRRRTEEDIKLANSV 190

Query: 175 DLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIR 234
           D+G+LRDPQQD ERVK+PEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYD+SGRIR
Sbjct: 191 DIGTLRDPQQDGERVKDPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDVSGRIR 250

Query: 235 KGPAPYNLEVPSYSFLDENKMLIG 258
           KGPAPYNLEVP+Y+FL++NK+LIG
Sbjct: 251 KGPAPYNLEVPTYTFLEDNKLLIG 274

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255543531|ref|XP_002512828.1| ubiquinol-cytochrome C reductase iron-sulfur subunit, putative [Ricinus communis] gi|223547839|gb|EEF49331.1| ubiquinol-cytochrome C reductase iron-sulfur subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449452030|ref|XP_004143763.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] gi|449516922|ref|XP_004165495.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357508447|ref|XP_003624512.1| Ubiquinol-cytochrome c reductase iron-sulfur subunit [Medicago truncatula] gi|355499527|gb|AES80730.1| Ubiquinol-cytochrome c reductase iron-sulfur subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|224053573|ref|XP_002297879.1| predicted protein [Populus trichocarpa] gi|222845137|gb|EEE82684.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|162458481|ref|NP_001105561.1| cytochrome b-c1 complex subunit Rieske, mitochondrial precursor [Zea mays] gi|1717957|sp|P49727.1|UCRI_MAIZE RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Flags: Precursor gi|168607|gb|AAA33507.1| Rieske Fe-S protein [Zea mays] Back     alignment and taxonomy information
>gi|388516897|gb|AFK46510.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|194691146|gb|ACF79657.1| unknown [Zea mays] gi|413918191|gb|AFW58123.1| cytochrome b-c1 complex subunit Rieske, Precursor(Rieske iron-sulfur protein) [Zea mays] Back     alignment and taxonomy information
>gi|388498708|gb|AFK37420.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|212723608|ref|NP_001131229.1| ubiquinol-cytochrome c reductase iron-sulfur subunit [Zea mays] gi|194690934|gb|ACF79551.1| unknown [Zea mays] gi|194701342|gb|ACF84755.1| unknown [Zea mays] gi|414587473|tpg|DAA38044.1| TPA: ubiquinol-cytochrome c reductase iron-sulfur subunit [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
TAIR|locus:2181670272 AT5G13430 [Arabidopsis thalian 0.759 0.720 0.877 1.2e-95
TAIR|locus:2181675274 AT5G13440 [Arabidopsis thalian 0.759 0.715 0.872 1.6e-95
UNIPROTKB|G4N4E1236 MGG_16866 "Ubiquinol-cytochrom 0.662 0.724 0.587 1.8e-55
SGD|S000000750215 RIP1 "Ubiquinol-cytochrome-c r 0.647 0.776 0.573 3e-53
ASPGD|ASPL0000046895228 AN2306 [Emericella nidulans (t 0.678 0.767 0.554 1.7e-52
ZFIN|ZDB-GENE-040426-2060273 uqcrfs1 "ubiquinol-cytochrome 0.674 0.637 0.536 1.2e-51
POMBASE|SPBC16H5.06228 rip1 "ubiquinol-cytochrome-c r 0.678 0.767 0.563 1.5e-51
UNIPROTKB|Q5ZLR5272 UQCRFS1 "Cytochrome b-c1 compl 0.755 0.716 0.475 8.3e-51
UNIPROTKB|G3MXD1271 UQCRFS1 "Ubiquinol-cytochrome 0.643 0.612 0.542 1.7e-50
UNIPROTKB|P13272274 UQCRFS1 "Cytochrome b-c1 compl 0.643 0.605 0.542 1.7e-50
TAIR|locus:2181670 AT5G13430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 951 (339.8 bits), Expect = 1.2e-95, P = 1.2e-95
 Identities = 172/196 (87%), Positives = 190/196 (96%)

Query:    63 VPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVL 122
             VPATV AVK P SKIVYD++NHERYPPGDPSKRAFAYFVL+GGRFVYAS++RLL+LK ++
Sbjct:    77 VPATVEAVKTPNSKIVYDDHNHERYPPGDPSKRAFAYFVLSGGRFVYASVLRLLVLKLIV 136

Query:   123 SMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDP 182
             SMSASKDVLA+ASLEVDL SIEPG+TVTVKWRGKPVFIRRRTE+DIKLANSVD+GSLRDP
Sbjct:   137 SMSASKDVLALASLEVDLGSIEPGTTVTVKWRGKPVFIRRRTEDDIKLANSVDVGSLRDP 196

Query:   183 QQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNL 242
             Q+D+ RVKNPEWLVVVGVCTHLGCIPLPNAGD+GGWFCPCHGSHYDISGRIRKGPAPYNL
Sbjct:   197 QEDSVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWFCPCHGSHYDISGRIRKGPAPYNL 256

Query:   243 EVPSYSFLDENKMLIG 258
             EVP+YSFL+ENK+LIG
Sbjct:   257 EVPTYSFLEENKLLIG 272
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016679 "oxidoreductase activity, acting on diphenols and related substances as donors" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA;TAS
GO:0046872 "metal ion binding" evidence=IDA
GO:0005750 "mitochondrial respiratory chain complex III" evidence=IDA
TAIR|locus:2181675 AT5G13440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N4E1 MGG_16866 "Ubiquinol-cytochrome c reductase iron-sulfur subunit" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
SGD|S000000750 RIP1 "Ubiquinol-cytochrome-c reductase, a Rieske iron-sulfur protein of the" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046895 AN2306 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2060 uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC16H5.06 rip1 "ubiquinol-cytochrome-c reductase complex subunit 5" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLR5 UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXD1 UQCRFS1 "Ubiquinol-cytochrome c reductase iron-sulfur subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P13272 UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P13272UCRI_BOVIN1, ., 1, 0, ., 2, ., 20.54210.64340.6058yesno
P08067UCRI_YEAST1, ., 1, 0, ., 2, ., 20.57920.63170.7581yesno
Q9CR68UCRI_MOUSE1, ., 1, 0, ., 2, ., 20.53010.64340.6058yesno
P37841UCRI_SOLTU1, ., 1, 0, ., 2, ., 20.87320.82170.8N/Ano
Q4UKR6UCRI_RICFE1, ., 1, 0, ., 2, ., 20.52460.61620.8983yesno
D5ANZ2UCRI_RHOCB1, ., 1, 0, ., 2, ., 20.50530.62010.8376yesno
Q92IR2UCRI_RICCN1, ., 1, 0, ., 2, ., 20.52460.61620.8983yesno
Q09154UCRI_SCHPO1, ., 1, 0, ., 2, ., 20.55300.68600.7763yesno
P51132UCRI2_TOBAC1, ., 1, 0, ., 2, ., 20.92850.75960.7205N/Ano
P51133UCRI3_TOBAC1, ., 1, 0, ., 2, ., 20.85060.84100.8097N/Ano
P51134UCRI4_TOBAC1, ., 1, 0, ., 2, ., 20.92850.75960.8305N/Ano
P51135UCRI5_TOBAC1, ., 1, 0, ., 2, ., 20.84610.84100.8097N/Ano
P47985UCRI_HUMAN1, ., 1, 0, ., 2, ., 20.53010.64340.6058yesno
P23136UCRI_RHORU1, ., 1, 0, ., 2, ., 20.53550.68210.9617yesno
P49729UCRI1_TOBAC1, ., 1, 0, ., 2, ., 20.93360.75960.7596N/Ano
P20788UCRI_RAT1, ., 1, 0, ., 2, ., 20.53610.64340.6058yesno
P49727UCRI_MAIZE1, ., 1, 0, ., 2, ., 20.72820.98830.9340N/Ano
Q69BK5UCRI_PANTR1, ., 1, 0, ., 2, ., 20.53010.64340.6058yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.10.2.20.979
3rd Layer1.10.20.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_I7944
hypothetical protein; Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis (By similarity) (275 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_IX0257
hypothetical protein (311 aa)
• ••••• 0.907
estExt_fgenesh4_pg.C_660168
SubName- Full=Putative uncharacterized protein; (311 aa)
• ••••• 0.904
eugene3.04990004
hypothetical protein (393 aa)
• • ••• 0.806
eugene3.04220005
annotation not avaliable (393 aa)
• • ••• 0.806
eugene3.03760011
annotation not avaliable (393 aa)
• • ••• 0.806
estExt_fgenesh4_pg.C_LG_I2224
succinate dehydrogenase (EC-1.3.5.1) (285 aa)
   • •• 0.800
gw1.20970.1.1
Predicted protein (302 aa)
• • ••• 0.753
gw1.297.1.1
hypothetical protein; Cytochrome c oxidase is the component of the respiratory chain that catal [...] (245 aa)
•  • •• 0.747
grail3.0635000201
hypothetical protein (190 aa)
   • •• 0.665
gw1.7821.1.1
cytochrome-c oxidase; Subunits I, II and III form the functional core of the enzyme complex (By [...] (215 aa)
     •• 0.491

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
cd03470126 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protei 5e-84
TIGR01416174 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c r 5e-70
COG0723177 COG0723, QcrA, Rieske Fe-S protein [Energy product 2e-43
pfam0035599 pfam00355, Rieske, Rieske [2Fe-2S] domain 3e-17
cd0346798 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster 1e-13
cd03471126 cd03471, Rieske_cytochrome_b6f, Iron-sulfur protei 3e-11
PRK13474178 PRK13474, PRK13474, cytochrome b6-f complex iron-s 1e-10
pfam0292163 pfam02921, UCR_TM, Ubiquinol cytochrome reductase 3e-10
cd0347791 cd03477, Rieske_YhfW_C, YhfW family, C-terminal Ri 4e-09
cd03476126 cd03476, Rieske_ArOX_small, Small subunit of Arsen 0.002
COG2146106 COG2146, {NirD}, Ferredoxin subunits of nitrite re 0.003
>gnl|CDD|239552 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information 
 Score =  246 bits (630), Expect = 5e-84
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 2/126 (1%)

Query: 135 SLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDP--QQDAERVKNP 192
            +EVDLS IE G  +TV+WRGKPVFIRRRT E+I  A +VDL  L DP    +  R   P
Sbjct: 1   PVEVDLSKIEEGQLITVEWRGKPVFIRRRTPEEIAEAKAVDLSLLDDPDPAANRVRSGKP 60

Query: 193 EWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDE 252
           EWLVV+G+CTHLGC+P   AGD+GG+FCPCHGSHYD SGRIRKGPAP NLEVP Y FL +
Sbjct: 61  EWLVVIGICTHLGCVPTYRAGDYGGFFCPCHGSHYDASGRIRKGPAPLNLEVPPYKFLSD 120

Query: 253 NKMLIG 258
             ++IG
Sbjct: 121 TTIVIG 126

The bc(1) complex is a multisubunit enzyme found in many different organisms including uni- and multi-cellular eukaryotes, plants (in their mitochondria) and bacteria. The cytochrome bc(1) and b6f complexes are central components of the respiratory and photosynthetic electron transport chains, respectively, which carry out similar core electron and proton transfer steps. The bc(1) and b6f complexes share a common core structure of three catalytic subunits: cyt b, the Rieske ISP, and either a cyt c1 in the bc(1) complex or cyt f in the b6f complex, which are arranged in an integral membrane-bound dimeric complex. While the core of the b6f complex is similar to that of the bc(1) complex, the domain arrangement outside the core and the complement of prosthetic groups are strikingly different. Length = 126
>gnl|CDD|233404 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|223795 COG0723, QcrA, Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215875 pfam00355, Rieske, Rieske [2Fe-2S] domain Back     alignment and domain information
>gnl|CDD|239550 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>gnl|CDD|239553 cd03471, Rieske_cytochrome_b6f, Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>gnl|CDD|237392 PRK13474, PRK13474, cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|217287 pfam02921, UCR_TM, Ubiquinol cytochrome reductase transmembrane region Back     alignment and domain information
>gnl|CDD|239559 cd03477, Rieske_YhfW_C, YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>gnl|CDD|239558 cd03476, Rieske_ArOX_small, Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>gnl|CDD|225057 COG2146, {NirD}, Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
KOG1671210 consensus Ubiquinol cytochrome c reductase, subuni 100.0
TIGR01416174 Rieske_proteo ubiquinol-cytochrome c reductase, ir 100.0
cd03470126 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) co 100.0
COG0723177 QcrA Rieske Fe-S protein [Energy production and co 100.0
PRK13474178 cytochrome b6-f complex iron-sulfur subunit; Provi 99.95
TIGR03171321 soxL2 Rieske iron-sulfur protein SoxL2. This iron- 99.9
cd0352898 Rieske_RO_ferredoxin Rieske non-heme iron oxygenas 99.85
cd03476126 Rieske_ArOX_small Small subunit of Arsenite oxidas 99.85
cd0347895 Rieske_AIFL_N AIFL (apoptosis-inducing factor like 99.84
TIGR02377101 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE 99.84
cd0353098 Rieske_NirD_small_Bacillus Small subunit of nitrit 99.83
PF0035597 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR01794 99.82
PRK09965106 3-phenylpropionate dioxygenase ferredoxin subunit; 99.81
cd0347791 Rieske_YhfW_C YhfW family, C-terminal Rieske domai 99.81
cd03474108 Rieske_T4moC Toluene-4-monooxygenase effector prot 99.8
cd03469118 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase ( 99.8
TIGR02694129 arsenite_ox_S arsenite oxidase, small subunit. Thi 99.79
cd0346798 Rieske Rieske domain; a [2Fe-2S] cluster binding d 99.76
cd03471126 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) co 99.76
cd03531115 Rieske_RO_Alpha_KSH The alignment model represents 99.75
cd04337129 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) 99.75
COG2146106 {NirD} Ferredoxin subunits of nitrite reductase an 99.74
PRK09511108 nirD nitrite reductase small subunit; Provisional 99.73
TIGR02378105 nirD_assim_sml nitrite reductase [NAD(P)H], small 99.72
cd03479144 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxy 99.72
cd03529103 Rieske_NirD Assimilatory nitrite reductase (NirD) 99.72
cd03532116 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxy 99.72
cd04338134 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-relate 99.71
cd03548136 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxy 99.68
cd03475171 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske doma 99.67
cd03480138 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase 99.66
cd03473107 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophospha 99.66
cd03536123 Rieske_RO_Alpha_DTDO This alignment model represen 99.64
PF13806104 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 99.63
cd03472128 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxy 99.62
cd03545150 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron ox 99.59
cd03541118 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase 99.57
cd03535123 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase 99.57
cd03537123 Rieske_RO_Alpha_PrnD This alignment model represen 99.56
cd03542123 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenas 99.54
cd03538146 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygena 99.54
cd03539129 Rieske_RO_Alpha_S5H This alignment model represent 99.53
PLN00095 394 chlorophyllide a oxygenase; Provisional 99.51
PLN02281 536 chlorophyllide a oxygenase 99.48
PLN02518 539 pheophorbide a oxygenase 99.3
TIGR03229 433 benzo_1_2_benA benzoate 1,2-dioxygenase, large sub 99.21
COG4638 367 HcaE Phenylpropionate dioxygenase and related ring 99.18
TIGR03228 438 anthran_1_2_A anthranilate 1,2-dioxygenase, large 99.17
PF1039941 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe- 98.5
PF0292164 UCR_TM: Ubiquinol cytochrome reductase transmembra 98.38
PF0880239 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit 94.76
TIGR0281166 formate_TAT formate dehydrogenase region TAT targe 89.35
PF1051826 TAT_signal: TAT (twin-arginine translocation) path 84.53
PF10080102 DUF2318: Predicted membrane protein (DUF2318); Int 83.96
TIGR0140929 TAT_signal_seq Tat (twin-arginine translocation) p 82.56
>KOG1671 consensus Ubiquinol cytochrome c reductase, subunit RIP1 [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=7e-53  Score=367.43  Aligned_cols=195  Identities=51%  Similarity=0.917  Sum_probs=180.3

Q ss_pred             CcccccccCCCccccccCcccccCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhhcceeeeeCCCC
Q 025100           64 PATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSI  143 (258)
Q Consensus        64 ~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~RR~Fl~~~~~g~~~v~a~~~~~~~~p~v~~~~ps~~~~A~a~v~VdlsdL  143 (258)
                      ...+++++.|+....+++.++++....++.|+.|.|++++++.+..+.+++..+..||.+|.++++++|++++|+++++|
T Consensus        16 ~~~~t~~~~p~~~~~~~~~~~~~~~~~~~~k~~~sy~~~g~~~~~~a~~ak~~v~~fi~smsAsadvlA~akiei~l~~I   95 (210)
T KOG1671|consen   16 GSSHTDLMVPDFSDYRRESVKDHQDTGEERKGFRSYLMVGAGAAGRAYAAKNLVTTFISSMSASADVLAMAKIEIKLSDI   95 (210)
T ss_pred             ccccccccCCCchhhhchhhhccccchhhhhceeeEEEecccceeehhhhhhhHHHHHHHhhhhhhhhhheeeeeeeecC
Confidence            34489999999888888888876666676667678888776666667777899999999999999999999999999999


Q ss_pred             CCCCeEEEEECCEEEEEEeCCHHHHHhhccCCCCCCCCcccccccccCCcEEEEEccccCCCeeccCCCCCCCEEEccCC
Q 025100          144 EPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCH  223 (258)
Q Consensus       144 ~pG~~~~v~w~GkPV~I~rRt~~~i~~~~~~~~~~lrDP~~~~~R~~~ge~~a~~~vCTHLGC~p~~~~gd~gg~~CPCH  223 (258)
                      |+|..++|+|+||||||.|||++||+.+++++.+.|||||.|.+|.++.+|++++++||||||+|.++.+|+|+|+||||
T Consensus        96 PeGk~~~~kwrGkpvfirhrt~~ei~~~r~V~~s~lrDPq~d~~rvk~~ewl~~igVCThLGCVp~~~AGd~gg~~CPCH  175 (210)
T KOG1671|consen   96 PEGKTVAFKWRGKPVFIRHRTKAEIEGERNVPQSTLRDPQDDVDRVKKPEWLVVIGVCTHLGCVPIANAGDYGGYYCPCH  175 (210)
T ss_pred             CCCCCcceeccCCceEEeeccccccccccccchhhccCchhhhhhccCcceEEEEeeeccccccccccccccCceecccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEeCCCCceecCCCCCCCcCceEEEeeCCEEEEC
Q 025100          224 GSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG  258 (258)
Q Consensus       224 GS~FDlsGrv~~GPAp~nL~vppy~~~~d~~I~IG  258 (258)
                      |||||.+||+++||||.||++|.|+|.++++|+||
T Consensus       176 GSHYdasGRIrkGPAPlnlevP~y~F~~~d~vivg  210 (210)
T KOG1671|consen  176 GSHYDASGRIRKGPAPLNLEVPTYEFTSEDKVIVG  210 (210)
T ss_pred             cccccccCceecCCCCCccCCCceecccCceEecC
Confidence            99999999999999999999999999887899887

>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>cd03470 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PRK13474 cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2 Back     alignment and domain information
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO) Back     alignment and domain information
>cd03476 Rieske_ArOX_small Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox) Back     alignment and domain information
>TIGR02377 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE subfamily Back     alignment and domain information
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain Back     alignment and domain information
>PF00355 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types Back     alignment and domain information
>PRK09965 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional Back     alignment and domain information
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms Back     alignment and domain information
>TIGR02694 arsenite_ox_S arsenite oxidase, small subunit Back     alignment and domain information
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>cd03471 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH) Back     alignment and domain information
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b Back     alignment and domain information
>COG2146 {NirD} Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09511 nirD nitrite reductase small subunit; Provisional Back     alignment and domain information
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit Back     alignment and domain information
>cd03479 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA) Back     alignment and domain information
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium Back     alignment and domain information
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd04338 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-related non-heme iron oxygenase associated with protein transport through the plant inner chloroplast membrane Back     alignment and domain information
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03475 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1) Back     alignment and domain information
>cd03473 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophosphate-N-acetylneuraminic acid (CMP Neu5Ac) hydroxylase family, N-terminal Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03536 Rieske_RO_Alpha_DTDO This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit (DitA) of diterpenoid dioxygenase (DTDO) Back     alignment and domain information
>PF13806 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 3C0D_A 3D89_A 2JZA_A Back     alignment and domain information
>cd03472 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxygenase (RO) family, Biphenyl dioxygenase (BPDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of BPDO and similar proteins including cumene dioxygenase (CumDO), nitrobenzene dioxygenase (NBDO), alkylbenzene dioxygenase (AkbDO) and dibenzofuran 4,4a-dioxygenase (DFDO) Back     alignment and domain information
>cd03545 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron oxygenase (RO) family, Ortho-halobenzoate-1,2-dioxygenase (OHBDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of OHBDO, salicylate 5-hydroxylase (S5H), terephthalate 1,2-dioxygenase system (TERDOS) and similar proteins Back     alignment and domain information
>cd03541 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase (RO) family, Choline monooxygenase (CMO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03535 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase (RO) family, Nathphalene 1,2-dioxygenase (NDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03537 Rieske_RO_Alpha_PrnD This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit of aminopyrrolnitrin oxygenase (PrnD) Back     alignment and domain information
>cd03542 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenase (RO) family, 2-Halobenzoate 1,2-dioxygenase (HBDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03538 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03539 Rieske_RO_Alpha_S5H This alignment model represents the N-terminal rieske iron-sulfur domain of the oxygenase alpha subunit (NagG) of salicylate 5-hydroxylase (S5H) Back     alignment and domain information
>PLN00095 chlorophyllide a oxygenase; Provisional Back     alignment and domain information
>PLN02281 chlorophyllide a oxygenase Back     alignment and domain information
>PLN02518 pheophorbide a oxygenase Back     alignment and domain information
>TIGR03229 benzo_1_2_benA benzoate 1,2-dioxygenase, large subunit Back     alignment and domain information
>COG4638 HcaE Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR03228 anthran_1_2_A anthranilate 1,2-dioxygenase, large subunit Back     alignment and domain information
>PF10399 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal; InterPro: IPR019470 This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex) Back     alignment and domain information
>PF02921 UCR_TM: Ubiquinol cytochrome reductase transmembrane region; InterPro: IPR004192 The ubiquinol cytochrome c reductase (cytochrome bc1) complex is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Back     alignment and domain information
>PF08802 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit ; InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions Back     alignment and domain information
>TIGR02811 formate_TAT formate dehydrogenase region TAT target Back     alignment and domain information
>PF10518 TAT_signal: TAT (twin-arginine translocation) pathway signal sequence; InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes [] Back     alignment and domain information
>PF10080 DUF2318: Predicted membrane protein (DUF2318); InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function Back     alignment and domain information
>TIGR01409 TAT_signal_seq Tat (twin-arginine translocation) pathway signal sequence Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1bcc_E196 Cytochrome Bc1 Complex From Chicken Length = 196 1e-57
1ezv_E185 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 1e-57
3cwb_E196 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 5e-55
1qcr_E196 Crystal Structure Of Bovine Mitochondrial Cytochrom 8e-55
1rie_A129 Structure Of A Water Soluble Fragment Of The Rieske 6e-48
1zrt_E191 Rhodobacter Capsulatus Cytochrome Bc1 Complex With 9e-46
2yiu_C190 X-Ray Structure Of The Dimeric Cytochrome Bc1 Compl 1e-44
2qjp_C179 Crystal Structure Of Wild Type Rhodobacter Sphaeroi 5e-41
2fyn_C187 Crystal Structure Analysis Of The Double Mutant Rho 2e-40
2qjk_C179 Crystal Structure Analysis Of Mutant Rhodobacter Sp 2e-40
2nuk_A141 Soluble Domain Of The Rieske Iron-Sulfur Protein Fr 1e-38
2nve_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 2e-38
2nvg_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 3e-38
2num_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 3e-38
2nwf_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 5e-38
2nvf_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 6e-38
1vf5_D179 Crystal Structure Of Cytochrome B6f Complex From M. 1e-09
2e74_D179 Crystal Structure Of The Cytochrome B6f Complex Fro 2e-09
3azc_A133 Crystal Structure Of The Soluble Part Of Cytochrome 3e-08
2zt9_D179 Crystal Structure Of The Cytochrome B6f Complex Fro 3e-08
1rfs_A139 Rieske Soluble Fragment From Spinach Length = 139 1e-07
1q90_C127 Structure Of The Cytochrome B6f (Plastohydroquinone 2e-06
>pdb|1BCC|E Chain E, Cytochrome Bc1 Complex From Chicken Length = 196 Back     alignment and structure 
Iteration: 1

 Score =  219 bits (558), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 130/179 (72%)
Query: 80  DEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVD 139
           D+Y+ +     DPS++ F+Y V        A   + ++ +FV SMSAS DVLAM+ +E+ 
Sbjct: 18  DDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIK 77
Query: 140 LSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVG 199
           LS I  G  +  KWRGKP+F+R RT+++I    +V++  LRDPQ D ERVK PEW++++G
Sbjct: 78  LSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIG 137
Query: 200 VCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG 258
           VCTHLGC+P+ NAGDFGG++CPCHGSHYD SGRIRKGPAP NLEVPSY F  ++ +++G
Sbjct: 138 VCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 196
>pdb|1EZV|E Chain E, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 185 Back     alignment and structure
>pdb|3CWB|E Chain E, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 196 Back     alignment and structure
>pdb|1QCR|E Chain E, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 196 Back     alignment and structure
>pdb|1RIE|A Chain A, Structure Of A Water Soluble Fragment Of The Rieske Iron- Sulfur Protein Of The Bovine Heart Mitochondrial Cytochrome Bc1-complex Length = 129 Back     alignment and structure
>pdb|1ZRT|E Chain E, Rhodobacter Capsulatus Cytochrome Bc1 Complex With Stigmatellin Bound Length = 191 Back     alignment and structure
>pdb|2YIU|C Chain C, X-Ray Structure Of The Dimeric Cytochrome Bc1 Complex From The Soil Bacterium Paracoccus Denitrificans At 2.7 Angstrom Resolution Length = 190 Back     alignment and structure
>pdb|2QJP|C Chain C, Crystal Structure Of Wild Type Rhodobacter Sphaeroides With Stigmatellin And Antimycin Inhibited Length = 179 Back     alignment and structure
>pdb|2FYN|C Chain C, Crystal Structure Analysis Of The Double Mutant Rhodobacter Sphaeroides Bc1 Complex Length = 187 Back     alignment and structure
>pdb|2QJK|C Chain C, Crystal Structure Analysis Of Mutant Rhodobacter Sphaeroides Bc1 With Stigmatellin And Antimycin Length = 179 Back     alignment and structure
>pdb|2NUK|A Chain A, Soluble Domain Of The Rieske Iron-Sulfur Protein From Rhodobacter Sphaeroides Length = 141 Back     alignment and structure
>pdb|2NVE|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVG|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NUM|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NWF|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVF|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|1VF5|D Chain D, Crystal Structure Of Cytochrome B6f Complex From M.Laminosus Length = 179 Back     alignment and structure
>pdb|2E74|D Chain D, Crystal Structure Of The Cytochrome B6f Complex From M.Laminosus Length = 179 Back     alignment and structure
>pdb|3AZC|A Chain A, Crystal Structure Of The Soluble Part Of Cytochrome B6f Complex Iron- Sulfur Subunit From Thermosynechococcus Elongatus Bp-1 Length = 133 Back     alignment and structure
>pdb|2ZT9|D Chain D, Crystal Structure Of The Cytochrome B6f Complex From Nostoc Sp. Pcc 7120 Length = 179 Back     alignment and structure
>pdb|1RFS|A Chain A, Rieske Soluble Fragment From Spinach Length = 139 Back     alignment and structure
>pdb|1Q90|C Chain C, Structure Of The Cytochrome B6f (Plastohydroquinone : Plastocyanin Oxidoreductase) From Chlamydomonas Reinhardtii Length = 127 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 1e-71
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 4e-69
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 5e-68
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 2e-67
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 2e-66
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 2e-54
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 4e-45
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 6e-40
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 4e-33
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 1e-18
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 2e-13
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Length = 196 Back     alignment and structure
 Score =  217 bits (553), Expect = 1e-71
 Identities = 90/170 (52%), Positives = 123/170 (72%)

Query: 89  PGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGST 148
               +++ F+Y V        A   + ++ +FV SMSAS DVLAM+ +E+ LS I  G  
Sbjct: 27  ESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKN 86

Query: 149 VTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIP 208
           +  KWRGKP+F+R RT+++I    +V++  LRDPQ D ERVK PEW++++GVCTHLGC+P
Sbjct: 87  MAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVP 146

Query: 209 LPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG 258
           + NAGDFGG++CPCHGSHYD SGRIRKGPAP NLEVPSY F  ++ +++G
Sbjct: 147 IANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 196
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Length = 185 Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Length = 141 Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Length = 129 Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Length = 187 Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Length = 133 Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Length = 179 Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Length = 165 Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Length = 139 Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Length = 204 Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 100.0
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 100.0
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 100.0
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 100.0
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 100.0
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 99.96
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 99.93
4aay_B175 AROB; oxidoreductase, rieske, iron sulfur, molybdo 99.91
3gce_A121 Ferredoxin component of carbazole 1,9A- dioxygenas 99.88
3dqy_A106 Toluene 1,2-dioxygenase system ferredoxin subunit; 99.87
2qpz_A103 Naphthalene 1,2-dioxygenase system ferredoxin subu 99.87
1fqt_A112 Rieske-type ferredoxin of biphenyl dioxygenase; 2F 99.86
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 99.85
2i7f_A108 Ferredoxin component of dioxygenase; rieske ferred 99.85
2de6_D115 Ferredoxin component of carbazole; electron transf 99.84
1vm9_A111 Toluene-4-monooxygenase system protein C; structur 99.83
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 99.82
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 99.8
2jo6_A113 Nitrite reductase [NAD(P)H] small subunit; all bet 99.79
3c0d_A119 Putative nitrite reductase NADPH (small subunit) o 99.79
2jza_A130 Nitrite reductase [NAD(P)H] small subunit; ISP dom 99.75
4aiv_A119 Probable nitrite reductase [NAD(P)H] small subuni; 99.75
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 99.54
3d89_A157 Rieske domain-containing protein; CAsp target, rie 99.67
3gke_A 349 DDMC; rieske cluster, non-heme mononuclear iron, o 99.61
2zyl_A 386 Possible oxidoreductase; KSHA, cholesterol, rieske 99.59
3gcf_A 394 Terminal oxygenase component of carbazole 1,9A- di 99.56
3gkq_A 389 Terminal oxygenase component of carbazole 1,9A- di 99.55
3vca_A 412 Ring-hydroxylating dioxygenase; rieske-type, monon 99.54
1z01_A 446 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.52
2de6_A 392 Terminal oxygenase component of carbazole; electro 99.52
3n0q_A 409 Putative aromatic-ring hydroxylating dioxygenase; 99.52
2gbw_A 454 Biphenyl 2,3-dioxygenase alpha subunit; rieske oxy 99.51
2bmo_A 447 Oxygenase-alpha NBDO; nitrobenzene dioxygenase, ni 99.49
2b1x_A 470 Naphthalene dioxygenase large subunit; rieske non- 99.48
1uli_A 460 Biphenyl dioxygenase large subunit; alpha3 BETA3 h 99.46
3gzx_A 457 Biphenyl dioxygenase subunit alpha; rieskie, non-h 99.36
1q90_R49 Cytochrome B6-F complex iron-sulfur subunit; membr 94.66
2pq4_B35 Periplasmic nitrate reductase precursor; NAPD/NAPA 81.21
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Back     alignment and structure
Probab=100.00  E-value=3.3e-50  Score=347.97  Aligned_cols=179  Identities=54%  Similarity=1.048  Sum_probs=165.2

Q ss_pred             ccccCcccccCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhhcceeeeeCCCCCCCCeEEEEECCE
Q 025100           77 IVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGK  156 (258)
Q Consensus        77 ~~~~~~~~~r~~~~~~~RR~Fl~~~~~g~~~v~a~~~~~~~~p~v~~~~ps~~~~A~a~v~VdlsdL~pG~~~~v~w~Gk  156 (258)
                      |+|++|+.  .+..+.+||+||+++++++++++++++..+++||+.+|+|+++++|.+.++|++++|++|+.++|+|+|+
T Consensus         7 ~~~~~~~~--~~~~~~~RR~fl~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~a~~~v~V~~s~l~~G~~~~v~~~g~   84 (185)
T 3cx5_E            7 PNFDDVLK--ENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGK   84 (185)
T ss_dssp             CCCTTTBC--CTTCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCGGGCCCCCEEEEGGGCCTTCEEEEEETTE
T ss_pred             CCchhhcc--CCCCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCcCCCcchhccCcEEEEHHHCCCCCeEEEEECCe
Confidence            46988853  3456789999999998777766666667889999999999999999999999999999999999999999


Q ss_pred             EEEEEeCCHHHHHhhccCCCCCCCCcccccccccCCcEEEEEccccCCCeeccCCCCCCCEEEccCCCeEeCCCCceecC
Q 025100          157 PVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKG  236 (258)
Q Consensus       157 PV~I~rRt~~~i~~~~~~~~~~lrDP~~~~~R~~~ge~~a~~~vCTHLGC~p~~~~gd~gg~~CPCHGS~FDlsGrv~~G  236 (258)
                      ||||+|++++||+.+.++++++||||+++.+|..+++|+|++++|||+||+|.+..++.++|+||||||+||++|++++|
T Consensus        85 pv~v~r~~~~~i~~~~~~~~~~l~dp~~~~~r~~~g~~~a~~~iCtHlGc~p~~~~~~~~~~~CPcHGs~FD~~G~v~~g  164 (185)
T 3cx5_E           85 PVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKG  164 (185)
T ss_dssp             EEEEEECCHHHHHHHHCSCGGGCSSCCCSTTTCSSTTEEEEECCCTTTSCCCEEEETTTTEEEETTTTEEECTTCCEEES
T ss_pred             EEEEEECCHHHhhhhhhcchhhhcCcccccccccCCeEEEEecccCCCCceeccCCCCCCEEEcCCCCCEECCCCCEecC
Confidence            99999999999999999999999999999999999999999999999999887766677899999999999999999999


Q ss_pred             CCCCCCcCceEEEeeCCEEEEC
Q 025100          237 PAPYNLEVPSYSFLDENKMLIG  258 (258)
Q Consensus       237 PAp~nL~vppy~~~~d~~I~IG  258 (258)
                      |++.||++|+|++ +|++|+||
T Consensus       165 Pa~~~L~v~p~~v-~~~~I~vg  185 (185)
T 3cx5_E          165 PAPLNLEIPAYEF-DGDKVIVG  185 (185)
T ss_dssp             SCCSCCCCCCEEE-ETTEEEEC
T ss_pred             CCCCCcceEEEEE-ECCEEEEC
Confidence            9999999999998 99999998
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Back     alignment and structure
>4aay_B AROB; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans} Back     alignment and structure
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} SCOP: b.33.1.0 PDB: 4emj_B* Back     alignment and structure
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida} Back     alignment and structure
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B* Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Back     alignment and structure
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae} Back     alignment and structure
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D* Back     alignment and structure
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Back     alignment and structure
>2jo6_A Nitrite reductase [NAD(P)H] small subunit; all beta, ISP domain, rieske iron-sulfur protein, 3-layer sandwich, structural genomics, PSI-2; NMR {Escherichia coli} SCOP: b.33.1.3 Back     alignment and structure
>3c0d_A Putative nitrite reductase NADPH (small subunit) oxidoreductase protein; NESG, VPR162, Q87HB1, XRAY, structure; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: b.33.1.3 Back     alignment and structure
>2jza_A Nitrite reductase [NAD(P)H] small subunit; ISP domain, rieske iron-sulfur protein, 3-layer beta- sandwich; NMR {Pectobacterium atrosepticum SCRI1043} SCOP: b.33.1.3 Back     alignment and structure
>4aiv_A Probable nitrite reductase [NAD(P)H] small subuni; oxidoreductase, nitrite metabolism; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Back     alignment and structure
>3d89_A Rieske domain-containing protein; CAsp target, rieske ferredoxin, [2Fe-2S] cluster, protein ST initiative, PSI; 2.07A {Mus musculus} Back     alignment and structure
>3gke_A DDMC; rieske cluster, non-heme mononuclear iron, oxygenase, oxidoreductase; 1.75A {Stenotrophomonas maltophilia} PDB: 3gb4_A 3gl0_A* 3gl2_A* 3gob_A* 3gte_A 3gts_A* Back     alignment and structure
>2zyl_A Possible oxidoreductase; KSHA, cholesterol, rieske; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3gcf_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske oxygenase, 2Fe-2S, electron transfer, oxidoreductase; 2.30A {Nocardioides aromaticivorans} Back     alignment and structure
>3gkq_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske nonheme iron oxygenase, electron transfer, putidaredoxin-type ferredoxin; 2.10A {Sphingomonas} Back     alignment and structure
>3vca_A Ring-hydroxylating dioxygenase; rieske-type, mononuclear non-heme iron, N-demethylase, oxido; 1.59A {Sinorhizobium meliloti} PDB: 3vcp_A Back     alignment and structure
>1z01_A 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygenase component; rieske center, oxygen binding/activation, substrate bound complex; 1.80A {Pseudomonas putida} SCOP: b.33.1.2 d.129.3.3 PDB: 1z02_A 1z03_A* Back     alignment and structure
>2de6_A Terminal oxygenase component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Janthinobacterium} SCOP: b.33.1.2 d.129.3.3 PDB: 1ww9_A 2de5_A 2de7_A* Back     alignment and structure
>3n0q_A Putative aromatic-ring hydroxylating dioxygenase; rieske [2Fe-2S] domain, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Back     alignment and structure
>2gbw_A Biphenyl 2,3-dioxygenase alpha subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_A* 2ckf_A Back     alignment and structure
>2bmo_A Oxygenase-alpha NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2bmq_A 2bmr_A* 2hmj_A 2hml_A* 2hmn_A* 1o7n_A 1ndo_A 1o7g_A* 1o7h_A 1o7m_A 1eg9_A 1o7p_A* 1o7w_A 1uuv_A 1uuw_A 2hmk_A* 2hmm_A* 2hmo_A* Back     alignment and structure
>2b1x_A Naphthalene dioxygenase large subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2b24_A Back     alignment and structure
>1uli_A Biphenyl dioxygenase large subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 1ulj_A* 3en1_A* 3eqq_A Back     alignment and structure
>3gzx_A Biphenyl dioxygenase subunit alpha; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} PDB: 3gzy_A* 1wql_A 2xso_A 2xsh_A 2xrx_A* 2xr8_A* 2yfi_A 2yfj_A* 2yfl_A* Back     alignment and structure
>1q90_R Cytochrome B6-F complex iron-sulfur subunit; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: f.23.12.1 Back     alignment and structure
>2pq4_B Periplasmic nitrate reductase precursor; NAPD/NAPA1-35, mixed beta-alpha sandwich structure, protein- peptide complex, alpha-helix; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d1riea_127 b.33.1.1 (A:) ISP subunit of the mitochondrial cyt 1e-55
d3cx5e1129 b.33.1.1 (E:87-215) ISP subunit of the mitochondri 2e-53
d1nyka_156 b.33.1.1 (A:) Soluble Rieske protein {Thermus ther 4e-25
d1jm1a_202 b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon S 2e-16
d1rfsa_127 b.33.1.1 (A:) ISP subunit from chloroplast cytochr 1e-15
d2e74d1134 b.33.1.1 (D:46-179) ISP subunit from the cytochrom 1e-12
d1ppje269 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cy 7e-10
d1g8kb_133 b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alc 2e-08
d3cx5e256 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of c 9e-05
d1fqta_109 b.33.1.1 (A:) Rieske-type ferredoxin associated wi 0.001
d1vm9a_109 b.33.1.1 (A:) Toluene-4-monooxygenase system prote 0.003
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  172 bits (437), Expect = 1e-55
 Identities = 76/127 (59%), Positives = 101/127 (79%)

Query: 132 AMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKN 191
           AM+ +E+ LS I  G  +  KWRGKP+F+R RT+++I    +V++  LRDPQ D ERVK 
Sbjct: 1   AMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKK 60

Query: 192 PEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLD 251
           PEW++++GVCTHLGC+P+ NAGDFGG++CPCHGSHYD SGRIRKGPAP NLEVPSY F  
Sbjct: 61  PEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTS 120

Query: 252 ENKMLIG 258
           ++ +++G
Sbjct: 121 DDMVIVG 127
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 129 Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 202 Back     information, alignment and structure
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 127 Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Length = 134 Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Length = 69 Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Length = 133 Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Length = 109 Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d3cx5e1129 ISP subunit of the mitochondrial cytochrome bc1-co 100.0
d1riea_127 ISP subunit of the mitochondrial cytochrome bc1-co 100.0
d1nyka_156 Soluble Rieske protein {Thermus thermophilus [TaxI 99.91
d1fqta_109 Rieske-type ferredoxin associated with biphenyl di 99.82
d1jm1a_202 Rieske protein II (SoxF) {Archaeon Sulfolobus acid 99.81
d1g8kb_133 Arsenite oxidase Rieske subunit {Alcaligenes faeca 99.8
d1rfsa_127 ISP subunit from chloroplast cytochrome bf complex 99.8
d1vm9a_109 Toluene-4-monooxygenase system protein C, TmoC {Ps 99.8
d3c0da1108 NADH-nitrite reductase small subunit NirD {Vibrio 99.8
d2e74d1134 ISP subunit from the cytochrome b6f complex, solub 99.78
d2jo6a1108 NADH-nitrite reductase small subunit NirD {Escheri 99.76
d2jzaa1122 NADH-nitrite reductase small subunit NirD {Erwinia 99.74
d1z01a1148 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.69
d2de6a1142 Terminal oxygenase component of carbazole CarAa {J 99.67
d2b1xa1162 Naphthalene 1,2-dioxygenase alpha subunit, N-domai 99.48
d1ulia1154 Biphenyl dioxygenase large subunit BphA1, N-termin 99.42
d2bmoa1150 Nitrobenzene dioxygenase alpha subunit, NBDO-alpha 99.39
d1ppje269 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 98.42
d3cx5e256 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 97.84
d2e74d234 ISP subunit from the cytochrome b6f complex, trans 91.62
d1q90r_39 ISP subunit from the cytochrome b6f complex, trans 88.99
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1e-45  Score=302.69  Aligned_cols=129  Identities=67%  Similarity=1.344  Sum_probs=124.8

Q ss_pred             hhhhcceeeeeCCCCCCCCeEEEEECCEEEEEEeCCHHHHHhhccCCCCCCCCcccccccccCCcEEEEEccccCCCeec
Q 025100          129 DVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIP  208 (258)
Q Consensus       129 ~~~A~a~v~VdlsdL~pG~~~~v~w~GkPV~I~rRt~~~i~~~~~~~~~~lrDP~~~~~R~~~ge~~a~~~vCTHLGC~p  208 (258)
                      |++|.++++||+++|++||+++|.|+||||||+|||++||+.+.+++.+.|.||+.+..|+.+++|+|++++||||||.+
T Consensus         1 dv~A~a~veVDis~l~pG~~~~V~WrGkPVfI~~Rt~e~i~~~~~~~~~~l~dp~~~~~r~~~~~~~v~~~~CtHlGC~~   80 (129)
T d3cx5e1           1 DVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVP   80 (129)
T ss_dssp             GGCCCCCEEEEGGGCCTTCEEEEEETTEEEEEEECCHHHHHHHHCSCGGGCSSCCCSTTTCSSTTEEEEECCCTTTSCCC
T ss_pred             CccccCceEEehhhCCCCCeEEEEeCCceEEEEecCHHHhhhccccccccccccccchhccccccEEEEEeeccCcceee
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCEEEccCCCeEeCCCCceecCCCCCCCcCceEEEeeCCEEEEC
Q 025100          209 LPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG  258 (258)
Q Consensus       209 ~~~~gd~gg~~CPCHGS~FDlsGrv~~GPAp~nL~vppy~~~~d~~I~IG  258 (258)
                      .+..+++++|+||||||+||++|++++||||+||++|||+| ++++|+||
T Consensus        81 ~~~~~~~~~~~CPCHgs~fd~~G~v~~GPA~~~L~~~~~~~-~~~~i~iG  129 (129)
T d3cx5e1          81 IGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEF-DGDKVIVG  129 (129)
T ss_dssp             EEEETTTTEEEETTTTEEECTTCCEEESSCCSCCCCCCEEE-ETTEEEEC
T ss_pred             eeccCcCCeEEEcCcCCCCCCCCCEEeCCCCCCCCCCcEEE-ECCEEEEC
Confidence            98888889999999999999999999999999999999998 77899998
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Back     information, alignment and structure
>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1z01a1 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2de6a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]} Back     information, alignment and structure
>d2b1xa1 b.33.1.2 (A:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure
>d1ulia1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure