Citrus Sinensis ID: 025128

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------

MVSQVLVALGLSLVGGLSTSIGALFVVLNEAPNLKVLGLLQGFAAGLMLSISFLDLAHNAINSIGFLKGNLWFFSGVIFFAIVANFIPEPSLAQGSDLTSKKKNKDEGGKDIMKKHRRQVLFSGIITAVGISLHNFPEGMAVFLGSMKGLRVGLNLAVAIALHNIPEGVAVALPVYFATQSKWQAFKLATLSGFAEPLGVIIVVGGVMAFLTLHEMLPLAFDYAGQKQAVKAVFVGMAFMSASLYFLEISLPAEMSL

ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccc

**SQVLVALGLSLVGGLSTSIGALFVVLNEAPNLKVLGLLQGFAAGLMLSISFLDLAHNAINSIGFLKGNLWFFSGVIFFAIVANFIPEPSLAQG*********************RRQVLFSGIITAVGISLHNFPEGMAVFLGSMKGLRVGLNLAVAIALHNIPEGVAVALPVYFATQSKWQAFKLATLSGFAEPLGVIIVVGGVMAFLTLHEMLPLAFDYAGQKQAVKAVFVGMAFMSASLYFLEISLPAEMSL

xxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxx

SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc transporter ZTP29	Zinc transporter involved response to salt stress. May act through the regulation of zinc levels required to induce the unfolded protein response (UPR) pathway.	confident	Q940Q3
Zinc transporter ZupT	Mediates zinc uptake. May also transport other divalent cations.	probable	Q57JS2
Zinc transporter ZupT	Mediates zinc uptake. May also transport other divalent cations.	probable	B7LQB7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted