Citrus Sinensis ID: 025140


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK
cccccHHHHHccccccccHHHHHHcccEEEEEccccHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHHHHccccEEEcccccccHHHccccEEEEEcccHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcc
****NNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glyoxylate/succinic semialdehyde reductase 2, chloroplastic Catalyzes the NADPH-dependent reduction of glyoxylate to glycolate as well as succinic semialdehyde (SSA) to gamma-hydroxybutyrate in vitro. May functions in redox homeostasis and play a role in oxidative stress tolerance by detoxifying glyoxylate and SSA generated in glycolate metabolism and GABA metabolism, respectively.probableF4I907
Uncharacterized oxidoreductase YfjR probableO34969

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DOJ, chain A
Confidence level:very confident
Coverage over the Query: 6-256
View the alignment between query and template
View the model in PyMOL