Citrus Sinensis ID: 025140

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK
cccccHHHHHccccccccHHHHHHcccEEEEEcccHHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcc
cHHHHHHHHHcccEEcccHHHHHHcccEEEEEccccccHHEEEEccccHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEcccccccHcccccEEEEEEcccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHcccHHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHccc
mktpnnafyysrcryqpspdevaasCDVTFamladpesamdvacgkhgaasgmgpgkgyvdvstvdgdtsklinghikatgasfleapvsgskkpaedGQLIFLAAGDKSLYNTVAPLldimgksrfylgdvgngaAMKLVVNMIMGSMMATFSEGLlhsekvgldpnVLVEVVSQgaisapmyslkgpsmieslyptafplkhQQKDLRLALGLaesvsqstPIAAAANELYKVAkshglsdeDFSAVIEALKAKK
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK
******AFYYSRCRYQP**DEVAASCDVTFAMLADP**AMDVACGK**********KGYVDVSTVDGDTSKLINGHIKATGASFL*************GQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAE*******IAAAANELYKV**********************
****NNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKA**
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTPNNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
F4I907358 Glyoxylate/succinic semia yes no 0.949 0.681 0.827 1e-113
Q9LSV0289 Glyoxylate/succinic semia no no 0.922 0.820 0.582 3e-72
Q5ZLS7553 Putative oxidoreductase G yes no 0.953 0.443 0.444 5e-55
Q5RKH0552 Putative oxidoreductase G yes no 0.953 0.443 0.440 1e-54
A4FUF0553 Putative oxidoreductase G yes no 0.953 0.443 0.440 2e-54
Q922P9546 Putative oxidoreductase G yes no 0.929 0.437 0.447 2e-54
Q49A26553 Putative oxidoreductase G yes no 0.953 0.443 0.440 3e-54
Q5R7T2553 Putative oxidoreductase G yes no 0.953 0.443 0.436 1e-53
Q562D5534 Putative oxidoreductase G yes no 0.914 0.440 0.442 3e-52
Q5RKN4462 Putative oxidoreductase G yes no 0.953 0.530 0.410 1e-50
>sp|F4I907|GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana GN=GLYR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  407 bits (1046), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/244 (82%), Positives = 223/244 (91%)

Query: 14  RYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLI 73
           +Y+ SP+EV A+CD+TFAMLADPESA+DVACGK+GA  G+  GKGYVDVSTVD  +S LI
Sbjct: 111 KYKSSPEEVTATCDLTFAMLADPESAIDVACGKNGAIFGISSGKGYVDVSTVDVASSILI 170

Query: 74  NGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVG 133
           +  IK TGA FLEAPVSGSKKPAEDGQLIFL AGDK LY   AP LDIMGKS+FYLG+VG
Sbjct: 171 SKQIKDTGALFLEAPVSGSKKPAEDGQLIFLTAGDKPLYEKAAPFLDIMGKSKFYLGEVG 230

Query: 134 NGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIE 193
           NGAAMKLVVNMIMGSMMA+F+EG+L S+KVGLDPNVLVEVVSQGAI+APMYSLKGPSMI+
Sbjct: 231 NGAAMKLVVNMIMGSMMASFAEGILLSQKVGLDPNVLVEVVSQGAINAPMYSLKGPSMIK 290

Query: 194 SLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEAL 253
           S+YPTAFPLKHQQKD+RLALGLAESVSQSTPIAAAANELYKVAKS+GLSDEDFSAVIEAL
Sbjct: 291 SVYPTAFPLKHQQKDMRLALGLAESVSQSTPIAAAANELYKVAKSYGLSDEDFSAVIEAL 350

Query: 254 KAKK 257
           KA K
Sbjct: 351 KAAK 354
Catalyzes the NADPH-dependent reduction of glyoxylate to glycolate as well as succinic semialdehyde (SSA) to gamma-hydroxybutyrate in vitro. May functions in redox homeostasis and play a role in oxidative stress tolerance by detoxifying glyoxylate and SSA generated in glycolate metabolism and GABA metabolism, respectively.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 1EC: 1
>sp|Q9LSV0|GLYR1_ARATH Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana GN=GLYR1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZLS7|GLYR1_CHICK Putative oxidoreductase GLYR1 OS=Gallus gallus GN=GLYR1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RKH0|GLYR1_RAT Putative oxidoreductase GLYR1 OS=Rattus norvegicus GN=Glyr1 PE=2 SV=1 Back     alignment and function description
>sp|A4FUF0|GLYR1_BOVIN Putative oxidoreductase GLYR1 OS=Bos taurus GN=GLYR1 PE=2 SV=1 Back     alignment and function description
>sp|Q922P9|GLYR1_MOUSE Putative oxidoreductase GLYR1 OS=Mus musculus GN=Glyr1 PE=2 SV=1 Back     alignment and function description
>sp|Q49A26|GLYR1_HUMAN Putative oxidoreductase GLYR1 OS=Homo sapiens GN=GLYR1 PE=1 SV=3 Back     alignment and function description
>sp|Q5R7T2|GLYR1_PONAB Putative oxidoreductase GLYR1 OS=Pongo abelii GN=GLYR1 PE=2 SV=2 Back     alignment and function description
>sp|Q562D5|GLYR1_XENTR Putative oxidoreductase GLYR1 OS=Xenopus tropicalis GN=glyr1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RKN4|GLYR1_DANRE Putative oxidoreductase GLYR1 OS=Danio rerio GN=glyr1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
224135037280 predicted protein [Populus trichocarpa] 0.945 0.867 0.901 1e-123
356550426333 PREDICTED: putative oxidoreductase GLYR1 0.945 0.729 0.888 1e-121
255560761348 3-hydroxyisobutyrate dehydrogenase, puta 0.945 0.698 0.893 1e-121
357454619339 hypothetical protein MTR_2g099910 [Medic 0.945 0.716 0.876 1e-120
225442309 365 PREDICTED: putative oxidoreductase GLYR1 0.945 0.665 0.876 1e-119
297743096343 unnamed protein product [Vitis vinifera] 0.945 0.708 0.876 1e-119
449458163311 PREDICTED: putative oxidoreductase GLYR1 0.945 0.781 0.872 1e-118
449458161356 PREDICTED: putative oxidoreductase GLYR1 0.945 0.682 0.876 1e-116
350538543 363 succinic semialdehyde reductase isofom2 0.945 0.669 0.847 1e-116
124359345332 Hydroxyacid dehydrogenase/reductase; 6-p 0.918 0.710 0.839 1e-113
>gi|224135037|ref|XP_002327551.1| predicted protein [Populus trichocarpa] gi|222836105|gb|EEE74526.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 232/243 (95%)

Query: 14  RYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLI 73
           +Y+PSP+EV A+CDVTFAMLADPE A++VACGKHGAASGMGPGKGYVDVSTVDG TSKLI
Sbjct: 35  KYKPSPEEVTAACDVTFAMLADPECAVEVACGKHGAASGMGPGKGYVDVSTVDGGTSKLI 94

Query: 74  NGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVG 133
            GHIKA+GASFLEAPVSGSKKPAEDGQLIFL AGDKSLY TVAP LDIMGKSRFYLG+VG
Sbjct: 95  CGHIKASGASFLEAPVSGSKKPAEDGQLIFLTAGDKSLYETVAPFLDIMGKSRFYLGEVG 154

Query: 134 NGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIE 193
           NGAAMKL+VNMIMGSMMATFSEGLL SEKVGLDPNVLVEVVS+GAISAPMYSLKGPSM++
Sbjct: 155 NGAAMKLIVNMIMGSMMATFSEGLLLSEKVGLDPNVLVEVVSEGAISAPMYSLKGPSMVK 214

Query: 194 SLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEAL 253
           SLYPTAFPLKHQQKD+RLALGLAESVSQ TPIAAAANELYKVAKSHGLSD DFSAVIEAL
Sbjct: 215 SLYPTAFPLKHQQKDMRLALGLAESVSQPTPIAAAANELYKVAKSHGLSDSDFSAVIEAL 274

Query: 254 KAK 256
           K K
Sbjct: 275 KGK 277

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356550426|ref|XP_003543588.1| PREDICTED: putative oxidoreductase GLYR1-like [Glycine max] Back     alignment and taxonomy information
>gi|255560761|ref|XP_002521394.1| 3-hydroxyisobutyrate dehydrogenase, putative [Ricinus communis] gi|223539472|gb|EEF41062.1| 3-hydroxyisobutyrate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357454619|ref|XP_003597590.1| hypothetical protein MTR_2g099910 [Medicago truncatula] gi|355486638|gb|AES67841.1| hypothetical protein MTR_2g099910 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225442309|ref|XP_002280297.1| PREDICTED: putative oxidoreductase GLYR1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743096|emb|CBI35963.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458163|ref|XP_004146817.1| PREDICTED: putative oxidoreductase GLYR1-like [Cucumis sativus] gi|449476650|ref|XP_004154796.1| PREDICTED: putative oxidoreductase GLYR1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449458161|ref|XP_004146816.1| PREDICTED: putative oxidoreductase GLYR1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|350538543|ref|NP_001233836.1| succinic semialdehyde reductase isofom2 [Solanum lycopersicum] gi|171854591|dbj|BAG16486.1| succinic semialdehyde reductase isofom2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|124359345|gb|ABD28508.2| Hydroxyacid dehydrogenase/reductase; 6-phosphogluconate dehydrogenase, C-terminal-like [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
TAIR|locus:2007923358 GLYR2 "glyoxylate reductase 2" 0.949 0.681 0.827 4.2e-102
TAIR|locus:2094518289 GLYR1 "glyoxylate reductase 1" 0.922 0.820 0.582 4e-67
TIGR_CMR|GSU_1372286 GSU_1372 "3-hydroxyisobutyrate 0.937 0.842 0.514 1.5e-60
UNIPROTKB|F1NFS2575 GLYR1 "Putative oxidoreductase 0.953 0.426 0.444 1.2e-51
UNIPROTKB|F1NFS3553 GLYR1 "Putative oxidoreductase 0.953 0.443 0.444 1.2e-51
UNIPROTKB|Q5ZLS7553 GLYR1 "Putative oxidoreductase 0.953 0.443 0.444 1.2e-51
UNIPROTKB|A4FUF0553 GLYR1 "Putative oxidoreductase 0.953 0.443 0.440 2.4e-51
UNIPROTKB|E2QVM3575 GLYR1 "Uncharacterized protein 0.953 0.426 0.440 2.4e-51
UNIPROTKB|F1RK86553 GLYR1 "Uncharacterized protein 0.953 0.443 0.440 2.4e-51
UNIPROTKB|I3LMN3539 GLYR1 "Uncharacterized protein 0.953 0.454 0.440 2.4e-51
TAIR|locus:2007923 GLYR2 "glyoxylate reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1012 (361.3 bits), Expect = 4.2e-102, P = 4.2e-102
 Identities = 202/244 (82%), Positives = 223/244 (91%)

Query:    14 RYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLI 73
             +Y+ SP+EV A+CD+TFAMLADPESA+DVACGK+GA  G+  GKGYVDVSTVD  +S LI
Sbjct:   111 KYKSSPEEVTATCDLTFAMLADPESAIDVACGKNGAIFGISSGKGYVDVSTVDVASSILI 170

Query:    74 NGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVG 133
             +  IK TGA FLEAPVSGSKKPAEDGQLIFL AGDK LY   AP LDIMGKS+FYLG+VG
Sbjct:   171 SKQIKDTGALFLEAPVSGSKKPAEDGQLIFLTAGDKPLYEKAAPFLDIMGKSKFYLGEVG 230

Query:   134 NGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIE 193
             NGAAMKLVVNMIMGSMMA+F+EG+L S+KVGLDPNVLVEVVSQGAI+APMYSLKGPSMI+
Sbjct:   231 NGAAMKLVVNMIMGSMMASFAEGILLSQKVGLDPNVLVEVVSQGAINAPMYSLKGPSMIK 290

Query:   194 SLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEAL 253
             S+YPTAFPLKHQQKD+RLALGLAESVSQSTPIAAAANELYKVAKS+GLSDEDFSAVIEAL
Sbjct:   291 SVYPTAFPLKHQQKDMRLALGLAESVSQSTPIAAAANELYKVAKSYGLSDEDFSAVIEAL 350

Query:   254 KAKK 257
             KA K
Sbjct:   351 KAAK 354
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0006098 "pentose-phosphate shunt" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0030267 "glyoxylate reductase (NADP) activity" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
TAIR|locus:2094518 GLYR1 "glyoxylate reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1372 GSU_1372 "3-hydroxyisobutyrate dehydrogenase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFS2 GLYR1 "Putative oxidoreductase GLYR1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFS3 GLYR1 "Putative oxidoreductase GLYR1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLS7 GLYR1 "Putative oxidoreductase GLYR1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUF0 GLYR1 "Putative oxidoreductase GLYR1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVM3 GLYR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RK86 GLYR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LMN3 GLYR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4I907GLYR2_ARATH1, ., 1, ., 1, ., n, 1, 10.82780.94940.6815yesno
O34969YFJR_BACSU1, ., 1, ., -, ., -0.30120.91820.8251yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_scaffold_44000035
hypothetical protein (280 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 9e-69
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 2e-36
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 5e-35
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reduct 6e-34
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 3e-33
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 3e-24
PRK15461296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybu 4e-22
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 5e-18
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 6e-12
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 8e-05
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 1e-04
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 2e-04
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information 
 Score =  213 bits (544), Expect = 9e-69
 Identities = 89/238 (37%), Positives = 132/238 (55%)

Query: 17  PSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGH 76
            SP E AA  DV   ML D  +   V  G++G   G+ PG   +D+ST+  +T++ +   
Sbjct: 49  ASPAEAAAEADVVITMLPDDAAVRAVLFGENGLLEGLKPGAIVIDMSTISPETARELAAA 108

Query: 77  IKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGA 136
           + A G  FL+APVSG    A  G L  +  GD   +    P+L+ MGK+  ++G VG G 
Sbjct: 109 LAAKGLEFLDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIVHVGPVGAGQ 168

Query: 137 AMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLY 196
           A KL  N+++   +A  +E L  +EK GLDP+V++EV+S GA  + +    GP M+E  +
Sbjct: 169 AAKLANNILLAGNIAALAEALALAEKAGLDPDVVLEVISGGAAGSWILENYGPRMLEGDF 228

Query: 197 PTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALK 254
              F +    KDL LAL  A+ +    P+ A A ELY  A + G  +EDFSA+I+ L+
Sbjct: 229 SPGFAVDLMLKDLGLALDAAKELGAPLPLTALAAELYAKAAAAGGGEEDFSALIKLLE 286

Length = 286
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
KOG0409327 consensus Predicted dehydrogenase [General functio 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 100.0
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 100.0
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 100.0
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.98
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.96
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.95
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.94
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.94
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.93
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.93
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.91
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.89
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.88
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.88
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.86
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.84
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.79
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.79
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.72
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.7
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.68
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.67
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.63
PLN02688266 pyrroline-5-carboxylate reductase 99.61
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.56
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.51
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.48
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.47
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.46
PRK08507275 prephenate dehydrogenase; Validated 99.45
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.37
PRK08655 437 prephenate dehydrogenase; Provisional 99.36
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 99.25
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.23
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.19
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.18
PRK07417279 arogenate dehydrogenase; Reviewed 99.17
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.07
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.01
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 98.96
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.92
PRK07502307 cyclohexadienyl dehydrogenase; Validated 98.87
PRK07680273 late competence protein ComER; Validated 98.87
PRK06545359 prephenate dehydrogenase; Validated 98.86
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 98.83
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 98.78
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.61
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 98.6
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.57
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 98.52
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 98.49
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 98.47
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.45
PLN02712667 arogenate dehydrogenase 98.45
PRK12921305 2-dehydropantoate 2-reductase; Provisional 98.45
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 98.41
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.4
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 98.35
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.32
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 98.25
PTZ00431260 pyrroline carboxylate reductase; Provisional 98.2
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.19
PRK08818370 prephenate dehydrogenase; Provisional 98.17
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 98.03
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.94
PRK05479330 ketol-acid reductoisomerase; Provisional 97.87
PLN02256304 arogenate dehydrogenase 97.82
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.77
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.73
PLN02712 667 arogenate dehydrogenase 97.66
PF00393 291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 97.63
PRK06249313 2-dehydropantoate 2-reductase; Provisional 97.61
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.6
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 97.59
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.51
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.5
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.5
PRK07574385 formate dehydrogenase; Provisional 97.48
PRK09287459 6-phosphogluconate dehydrogenase; Validated 97.46
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 97.46
PLN03139386 formate dehydrogenase; Provisional 97.41
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.19
PRK06436303 glycerate dehydrogenase; Provisional 97.11
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 97.07
PRK13243333 glyoxylate reductase; Reviewed 97.07
PRK08605332 D-lactate dehydrogenase; Validated 97.06
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 96.92
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 96.89
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.66
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.56
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 96.41
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.35
PRK06141314 ornithine cyclodeaminase; Validated 96.2
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.1
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 95.99
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 95.97
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.95
PRK06444197 prephenate dehydrogenase; Provisional 95.92
PRK12480330 D-lactate dehydrogenase; Provisional 95.86
PRK13403335 ketol-acid reductoisomerase; Provisional 95.73
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 95.71
PRK11730 715 fadB multifunctional fatty acid oxidation complex 95.65
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.62
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 95.6
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.5
PRK13302271 putative L-aspartate dehydrogenase; Provisional 95.4
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 95.38
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 95.32
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.3
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 94.95
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 94.87
PLN02928347 oxidoreductase family protein 94.77
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 94.68
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.61
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 94.46
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 94.23
PF10728132 DUF2520: Domain of unknown function (DUF2520); Int 94.22
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.2
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 94.2
PRK06487317 glycerate dehydrogenase; Provisional 94.19
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 93.95
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.95
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 93.88
PRK06932314 glycerate dehydrogenase; Provisional 93.84
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.79
PRK13304265 L-aspartate dehydrogenase; Reviewed 93.29
PLN02306386 hydroxypyruvate reductase 93.05
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 92.81
PF05222136 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal 92.79
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 92.59
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 92.18
PRK08306296 dipicolinate synthase subunit A; Reviewed 92.16
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 92.01
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 91.59
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 90.66
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 90.64
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 90.33
PRK08306296 dipicolinate synthase subunit A; Reviewed 90.19
PF0913073 DUF1932: Domain of unknown function (DUF1932); Int 90.18
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 90.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 88.93
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 88.9
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 88.1
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 87.82
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 87.59
PRK05225 487 ketol-acid reductoisomerase; Validated 87.29
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 86.74
PF10100429 DUF2338: Uncharacterized protein conserved in bact 86.21
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 86.15
COG5495289 Uncharacterized conserved protein [Function unknow 85.72
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 85.24
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 85.23
PTZ00187317 succinyl-CoA synthetase alpha subunit; Provisional 85.04
PRK11579346 putative oxidoreductase; Provisional 84.77
COG4408431 Uncharacterized protein conserved in bacteria [Fun 84.59
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 83.72
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 83.68
TIGR00036266 dapB dihydrodipicolinate reductase. 83.43
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 83.4
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 83.04
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 83.03
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 82.58
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.67
PRK10206344 putative oxidoreductase; Provisional 81.31
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 81.03
PLN02522 608 ATP citrate (pro-S)-lyase 80.59
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 80.42
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 80.2
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.11
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=8.8e-64  Score=429.45  Aligned_cols=250  Identities=36%  Similarity=0.567  Sum_probs=245.1

Q ss_pred             chhhhhcCccccCCHHHHHhcCCEEEEecCChHHHHHHhcCCCcccccCCCCCEEEEcCCCCHHHHHHHHHHHHHcCCcE
Q 025140            5 NNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASF   84 (257)
Q Consensus         5 ~~~~~~~Ga~~~~s~~ea~~~advvi~~l~~~~~v~~v~~~~~~~~~~l~~g~~ivd~ST~~p~~~~~la~~~~~~G~~~   84 (257)
                      .+.+++.|++.+.||+|+++.+|+||+||+|+++|++|++|++++++++.+|++||||||++|++++++++.++++|.+|
T Consensus        37 ~~~~~~~Ga~~a~s~~eaa~~aDvVitmv~~~~~V~~V~~g~~g~~~~~~~G~i~IDmSTisp~~a~~~a~~~~~~G~~~  116 (286)
T COG2084          37 AELLAAAGATVAASPAEAAAEADVVITMLPDDAAVRAVLFGENGLLEGLKPGAIVIDMSTISPETARELAAALAAKGLEF  116 (286)
T ss_pred             hHHHHHcCCcccCCHHHHHHhCCEEEEecCCHHHHHHHHhCccchhhcCCCCCEEEECCCCCHHHHHHHHHHHHhcCCcE
Confidence            34577789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCCCChHHhhcCceEEEecCChhHHHHHHHHHHHhcCCceecCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Q 025140           85 LEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVG  164 (257)
Q Consensus        85 vdapV~g~~~~a~~g~l~i~~gg~~~~~~~~~~ll~~~~~~~~~~G~~G~a~~~Kl~~n~~~~~~~~~~~Ea~~la~~~G  164 (257)
                      +|+||+|++..+++|+|+||+||++++|++++|+|+.++++++|+|+.|+|+.+|++||++.++++++++|++.|+++.|
T Consensus       117 lDAPVsGg~~~A~~GtLtimvGG~~~~f~r~~pvl~~~g~~i~~~G~~G~G~~~Kl~nn~l~~~~~~a~aEAl~la~k~G  196 (286)
T COG2084         117 LDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIVHVGPVGAGQAAKLANNILLAGNIAALAEALALAEKAG  196 (286)
T ss_pred             EecCccCCchhhhhCceEEEeCCCHHHHHHHHHHHHHhcCceEEECCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHhhcCCCchhhhccccccccCCCCCCCchhhHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHCCCCCc
Q 025140          165 LDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDE  244 (257)
Q Consensus       165 ld~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~~f~~~~~~KD~~~~~~~a~~~g~~~p~~~~~~~~~~~a~~~g~g~~  244 (257)
                      +|++.++++++.+++.||+++++.|+|++++|.|+|+++++.||++++++++++.|+++|+...+.++|+.+.+.|+|++
T Consensus       197 ld~~~~~~vi~~~~~~s~~~e~~~~~m~~~~~~p~F~v~~~~KDl~la~~~A~~~g~~lP~~~~~~~ly~~~~~~G~g~~  276 (286)
T COG2084         197 LDPDVVLEVISGGAAGSWILENYGPRMLEGDFSPGFAVDLMLKDLGLALDAAKELGAPLPLTALAAELYAKAAAAGGGEE  276 (286)
T ss_pred             CCHHHHHHHHhccccCChHHHhhcchhhcCCCCcchhHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHhcCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHH
Q 025140          245 DFSAVIEALK  254 (257)
Q Consensus       245 d~~a~~~~~~  254 (257)
                      |++++++.++
T Consensus       277 D~sal~~~l~  286 (286)
T COG2084         277 DFSALIKLLE  286 (286)
T ss_pred             ChHHHHHHhC
Confidence            9999999874

>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PF10728 DUF2520: Domain of unknown function (DUF2520); InterPro: IPR018931 This presumed domain is found C-terminal to a Rossmann-like domain suggesting that these proteins are oxidoreductases Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PF09130 DUF1932: Domain of unknown function (DUF1932); InterPro: IPR015814 This domain has been found in a number of eukaryotic and prokaryotic proteins, some of which are predicted to be 6-phosphogluconate dehydrogenase, NAD-binding proteins Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>PLN02522 ATP citrate (pro-S)-lyase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 3e-73
3pef_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 2e-69
3pdu_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 1e-66
2uyy_A316 Structure Of The Cytokine-Like Nuclear Factor N-Pac 6e-56
1yb4_A295 Crystal Structure Of The Tartronic Semialdehyde Red 4e-27
3cky_A301 Structural And Kinetic Properties Of A Beta-Hydroxy 3e-24
1vpd_A299 X-Ray Crystal Structure Of Tartronate Semialdehyde 9e-23
2i9p_A319 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 3e-21
2gf2_A296 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 3e-21
4dll_A320 Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Re 4e-17
1wp4_A289 Structure Of Tt368 Protein From Thermus Thermophilu 4e-14
2cvz_A289 Structure Of Hydroxyisobutyrate Dehydrogenase From 3e-13
3g0o_A303 Crystal Structure Of 3-Hydroxyisobutyrate Dehydroge 6e-11
3qha_A296 Crystal Structure Of A Putative Oxidoreductase From 1e-09
3q3c_A299 Crystal Structure Of A Serine Dehydrogenase From Ps 1e-07
3obb_A300 Crystal Structure Of A Possible 3-Hydroxyisobutyrat 1e-07
4gbj_A297 Crystal Structure Of Nad-Binding 6-Phosphogluconate 8e-06
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure 
Iteration: 1

 Score =  271 bits (692), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 170/237 (71%)
Query: 18  SPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHI 77
           SP EV   C  T AML+DP +A+ V   K G    +  GKGY+D+STVD +TS  IN  I
Sbjct: 70  SPAEVIKKCKYTIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAI 129
Query: 78  KATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAA 137
              G  F+E PVSGSKKPAEDGQLI LAAGDK+L+    P  D++GK  FYLG VGNGA 
Sbjct: 130 TGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAK 189
Query: 138 MKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYP 197
           MKL+VNMIMGSMM  FSEGL+ ++K GL  + L++++  GA++ PM+  KGPSM +S YP
Sbjct: 190 MKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYP 249
Query: 198 TAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALK 254
            AFPLKHQQKD+RLAL L +  + S P+AAAANE +K A+S GL D DFSAVIEA+K
Sbjct: 250 PAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVK 306
>pdb|3PEF|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Metallireducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|3PDU|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Sulfurreducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|2UYY|A Chain A, Structure Of The Cytokine-Like Nuclear Factor N-Pac Length = 316 Back     alignment and structure
>pdb|1YB4|A Chain A, Crystal Structure Of The Tartronic Semialdehyde Reductase From Salmonella Typhimurium Lt2 Length = 295 Back     alignment and structure
>pdb|3CKY|A Chain A, Structural And Kinetic Properties Of A Beta-Hydroxyacid Dehydrogenase Involved In Nicotinate Fermentation Length = 301 Back     alignment and structure
>pdb|1VPD|A Chain A, X-Ray Crystal Structure Of Tartronate Semialdehyde Reductase [salmonella Typhimurium Lt2] Length = 299 Back     alignment and structure
>pdb|2I9P|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Complexed With Nad+ Length = 319 Back     alignment and structure
>pdb|2GF2|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Length = 296 Back     alignment and structure
>pdb|4DLL|A Chain A, Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Reductase From Polaromonas Sp. Js666 Length = 320 Back     alignment and structure
>pdb|1WP4|A Chain A, Structure Of Tt368 Protein From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|2CVZ|A Chain A, Structure Of Hydroxyisobutyrate Dehydrogenase From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|3G0O|A Chain A, Crystal Structure Of 3-Hydroxyisobutyrate Dehydrogenase (Ygbj) From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|3QHA|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Mycobacterium Avium 104 Length = 296 Back     alignment and structure
>pdb|3Q3C|A Chain A, Crystal Structure Of A Serine Dehydrogenase From Pseudomonas Aeruginosa Pao1 In Complex With Nad Length = 299 Back     alignment and structure
>pdb|3OBB|A Chain A, Crystal Structure Of A Possible 3-Hydroxyisobutyrate Dehydrogenase From Pseudomonas Aeruginosa Pao1 Length = 300 Back     alignment and structure
>pdb|4GBJ|A Chain A, Crystal Structure Of Nad-Binding 6-Phosphogluconate Dehydrogenase From Dyadobacter Fermentans Length = 297 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 5e-93
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 6e-93
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 7e-93
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 1e-92
3l6d_A306 Putative oxidoreductase; structural genomics, prot 4e-72
1vpd_A299 Tartronate semialdehyde reductase; structural geno 4e-62
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 1e-61
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 1e-60
1yb4_A295 Tartronic semialdehyde reductase; structural genom 2e-60
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 8e-60
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 4e-58
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 6e-56
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 1e-55
3qha_A296 Putative oxidoreductase; seattle structural genomi 6e-47
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 3e-40
4ezb_A317 Uncharacterized conserved protein; structural geno 1e-29
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 3e-21
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
 Score =  274 bits (704), Expect = 5e-93
 Identities = 131/241 (54%), Positives = 166/241 (68%)

Query: 14  RYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLI 73
               +P EV  SC VTFAMLADP +A +V  GKHG   G+G G+GYVD+STVD  TS+ I
Sbjct: 46  ERAATPCEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRI 105

Query: 74  NGHIKATGASFLEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVG 133
              + A G  FLEAPVSGSKKPAEDG LI LAAGD++LY+   P  + MGK   +LGDVG
Sbjct: 106 GVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPGFEKMGKKIIHLGDVG 165

Query: 134 NGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIE 193
            GA MKLVVNM+MG MMA F EGL   EK GL  + +++V+  GA++ PM++LKG  + +
Sbjct: 166 KGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATDAILDVIGAGAMANPMFALKGGLIRD 225

Query: 194 SLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEAL 253
             +  AFPLKH QKDLRLA+ L + V Q    +AAANEL+K A++ G  DEDFSA+ +  
Sbjct: 226 RNFAPAFPLKHMQKDLRLAVALGDRVGQPLVASAAANELFKGARAAGFGDEDFSAIFKTY 285

Query: 254 K 254
           +
Sbjct: 286 E 286
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 100.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 100.0
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 100.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 100.0
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 100.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 100.0
3l6d_A306 Putative oxidoreductase; structural genomics, prot 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 100.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 100.0
4ezb_A317 Uncharacterized conserved protein; structural geno 100.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 100.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 100.0
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 100.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 100.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 100.0
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.97
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.97
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.96
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.96
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.96
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.96
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.96
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.95
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.95
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 99.94
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.94
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.94
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.93
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.91
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.9
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.84
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.77
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.76
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.75
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.74
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.71
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.71
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.7
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.69
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.69
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.68
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.66
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.64
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.64
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.62
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.61
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.58
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.56
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.52
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.48
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.36
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.35
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.31
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.27
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.27
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.9
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.23
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.23
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.22
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.19
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.18
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.17
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.15
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.13
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.08
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.08
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.03
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.02
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.0
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.9
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.88
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.77
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.69
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 98.54
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 98.51
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 98.5
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 98.48
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 98.45
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.34
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.87
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.85
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 97.73
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 97.73
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 97.67
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 97.64
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 97.62
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.59
2duw_A145 Putative COA-binding protein; ligand binding prote 97.58
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.55
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.53
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.53
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.53
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.52
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.52
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.51
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.51
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 97.47
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.39
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.38
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.34
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.33
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.32
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.3
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.3
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.28
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.28
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.27
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.25
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.25
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.21
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.16
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.14
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.12
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.09
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.08
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.0
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.99
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 96.98
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.94
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.85
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 96.82
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.71
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.65
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 96.63
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.63
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 96.49
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 96.23
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.14
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.08
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.07
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 96.02
2d59_A144 Hypothetical protein PH1109; COA binding, structur 95.83
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 95.76
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 95.75
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 95.6
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 95.51
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.2
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 95.1
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 95.01
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 95.0
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 94.87
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 94.71
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 94.7
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 94.6
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 94.6
3euw_A344 MYO-inositol dehydrogenase; protein structure init 94.41
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.41
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 94.37
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 94.31
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 94.19
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 94.06
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 94.05
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 94.04
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.01
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 93.96
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.95
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 93.93
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 93.91
1ydw_A362 AX110P-like protein; structural genomics, protein 93.87
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 93.78
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 93.75
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 93.73
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 93.47
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 93.42
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.35
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 93.23
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 92.94
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 92.92
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 92.53
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 92.47
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 92.24
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 91.81
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 91.66
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 91.4
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 91.33
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 90.87
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 90.59
2g0t_A350 Conserved hypothetical protein; structural genomic 90.5
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 90.38
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 90.36
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 90.33
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 89.94
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 89.86
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 89.71
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 89.02
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 88.87
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 88.41
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 88.05
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 88.0
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.85
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 87.62
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 87.38
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 87.36
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 86.51
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 86.51
1lss_A140 TRK system potassium uptake protein TRKA homolog; 86.43
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 85.75
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 85.72
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 85.49
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 84.12
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 84.09
3oqb_A383 Oxidoreductase; structural genomics, protein struc 82.95
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 81.59
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 81.26
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 81.11
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 81.04
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 80.77
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 80.53
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-60  Score=417.77  Aligned_cols=252  Identities=24%  Similarity=0.393  Sum_probs=243.6

Q ss_pred             chhhhhcCccccCCHHHHHhcCCEEEEecCChHHHHHHhcCCCcccccCCCCCEEEEcCCCCHHHHHHHHHHHHHcCCcE
Q 025140            5 NNAFYYSRCRYQPSPDEVAASCDVTFAMLADPESAMDVACGKHGAASGMGPGKGYVDVSTVDGDTSKLINGHIKATGASF   84 (257)
Q Consensus         5 ~~~~~~~Ga~~~~s~~ea~~~advvi~~l~~~~~v~~v~~~~~~~~~~l~~g~~ivd~ST~~p~~~~~la~~~~~~G~~~   84 (257)
                      .++|++.|++.++|++|++++||+||+|||+++++++|+++.+++++.+.+|++|||+||++|+++++++++++++|++|
T Consensus        39 ~~~l~~~Ga~~a~s~~e~~~~~dvv~~~l~~~~~v~~V~~~~~g~~~~~~~g~iiId~sT~~p~~~~~~a~~~~~~G~~~  118 (300)
T 3obb_A           39 VDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDDGLLAHIAPGTLVLECSTIAPTSARKIHAAARERGLAM  118 (300)
T ss_dssp             HHHHHHTTCEECSSHHHHHTTCSEEEECCSCHHHHHHHHHSSSSSTTSCCC-CEEEECSCCCHHHHHHHHHHHHTTTCEE
T ss_pred             HHHHHHcCCEEcCCHHHHHhcCCceeecCCchHHHHHHHhchhhhhhcCCCCCEEEECCCCCHHHHHHHHHHHHHcCCEE
Confidence            47799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCCCChHHhhcCceEEEecCChhHHHHHHHHHHHhcCCceecCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Q 025140           85 LEAPVSGSKKPAEDGQLIFLAAGDKSLYNTVAPLLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVG  164 (257)
Q Consensus        85 vdapV~g~~~~a~~g~l~i~~gg~~~~~~~~~~ll~~~~~~~~~~G~~G~a~~~Kl~~n~~~~~~~~~~~Ea~~la~~~G  164 (257)
                      +||||+|+|.+|++|+|++|+||++++|++++|+|+.|+++++|+|+.|+|+.+|++||++.++++++++|++.++++.|
T Consensus       119 lDaPVsGg~~~A~~G~L~imvGG~~~~~~~~~p~l~~~g~~i~~~G~~G~g~~~Kl~~N~l~~~~~~a~aEa~~la~~~G  198 (300)
T 3obb_A          119 LDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFHAGPDGAGQVAKVCNNQLLAVLMIGTAEAMALGVANG  198 (300)
T ss_dssp             EECCEESCHHHHHHTCEEEEEESCHHHHHHHHHHHHHHEEEEEEEESTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             EecCCCCCHHHHHhCCEEEEEeCCHHHHHHHHHHHHHhCCCEEEeCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHhhcCCCchhhhcccc-------ccccCCCCCCCchhhHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHH
Q 025140          165 LDPNVLVEVVSQGAISAPMYSLKGP-------SMIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAK  237 (257)
Q Consensus       165 ld~~~~~~~l~~~~~~s~~~~~~~~-------~~~~~~~~~~f~~~~~~KD~~~~~~~a~~~g~~~p~~~~~~~~~~~a~  237 (257)
                      +|++.++++++.+++.||.++.+.|       .+..++|.++|+++++.||++++++++++.|+|+|+++.+.++|+++.
T Consensus       199 ld~~~~~~vl~~~~~~s~~~~~~~p~~~~~~~~~~~~~~~~~f~~~l~~KDl~l~~~~A~~~g~~~p~~~~a~~~~~~a~  278 (300)
T 3obb_A          199 LEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQLMAKDLGLAQEAAQASASSTPMGSLALSLYRLLL  278 (300)
T ss_dssp             CCHHHHHHHHHTSTTCCHHHHHCCCSTTTSTTSGGGGTTCSSSBHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHhCcccchHHHhhccccchhhhccccccCCccchHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHH
Confidence            9999999999999999999998876       356788999999999999999999999999999999999999999999


Q ss_pred             HCCCCCcchHHHHHHHHhC
Q 025140          238 SHGLSDEDFSAVIEALKAK  256 (257)
Q Consensus       238 ~~g~g~~d~~a~~~~~~~~  256 (257)
                      +.|+|++|+++|+++|++.
T Consensus       279 ~~G~g~~D~sal~~~~e~~  297 (300)
T 3obb_A          279 KQGYAERDFSVVQKLFDPT  297 (300)
T ss_dssp             HTTCTTSBGGGGHHHHCTT
T ss_pred             hCCCCCcCHHHHHHHHHHh
Confidence            9999999999999999864
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 257
d1vpda1133 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydroge 3e-28
d3cuma1134 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydroge 4e-26
d2cvza1132 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydroge 1e-25
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 2e-20
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 8e-19
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 2e-09
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 8e-05
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 0.002
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 133 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]

 Score =  102 bits (256), Expect = 3e-28
 Identities = 31/124 (25%), Positives = 60/124 (48%)

Query: 131 DVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPS 190
           D+G G   KL   +I+   +A  SE L  + K G++P+++ + +  G   + +   K P 
Sbjct: 1   DIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPM 60

Query: 191 MIESLYPTAFPLKHQQKDLRLALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVI 250
           +++  +   F +    KDL  AL  +  V    P+ AA  E+ +  ++ G  ++D SA+ 
Sbjct: 61  VMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSALA 120

Query: 251 EALK 254
              +
Sbjct: 121 CYYE 124
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.96
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.96
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.95
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.95
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.94
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.91
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.88
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.8
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.69
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.66
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.39
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.03
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.98
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 98.87
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 98.68
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 98.49
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.28
d1i36a1112 Conserved hypothetical protein MTH1747 {Archaeon M 98.11
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.02
d2pgda1 297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 97.96
d1pgja1 300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 97.88
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.39
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.83
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 95.95
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.68
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.44
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.3
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 94.96
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.89
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.88
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 94.85
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 94.61
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 94.1
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.31
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 93.22
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.78
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.66
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 90.58
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 90.3
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.9
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 88.99
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 88.8
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 87.77
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 86.63
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 85.9
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 85.73
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 83.89
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 82.63
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 81.38
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 81.24
d1bg6a1172 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 81.17
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]

Probab=99.96  E-value=4.5e-29  Score=191.24  Aligned_cols=125  Identities=25%  Similarity=0.441  Sum_probs=122.7

Q ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhhcCCCchhhhccccccccCCCCCCCchhhHHHHHH
Q 025140          131 DVGNGAAMKLVVNMIMGSMMATFSEGLLHSEKVGLDPNVLVEVVSQGAISAPMYSLKGPSMIESLYPTAFPLKHQQKDLR  210 (257)
Q Consensus       131 ~~G~a~~~Kl~~n~~~~~~~~~~~Ea~~la~~~Gld~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~~f~~~~~~KD~~  210 (257)
                      ++|+|+.+|+++|++.++++.+++|++.+|++.|+|++.++++++.+++.||+++.+.|++++++|.|+|+++++.||++
T Consensus         1 dvG~g~~~Kl~nN~l~~~~~~~~aEal~la~~~Gid~~~~~~~l~~~~~~S~~~~~~~~~~~~~~~~~~f~~~l~~KDl~   80 (133)
T d1vpda1           1 DIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLA   80 (133)
T ss_dssp             STTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHTTSTTCCHHHHHHHHHHHTTCCCCSSBHHHHHHHHH
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHhccccchhhhhccchhhhccCCCCchHHHHHHHHH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCcHHHHHHHHHHHHHHHCCCCCcchHHHHHHHHh
Q 025140          211 LALGLAESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKA  255 (257)
Q Consensus       211 ~~~~~a~~~g~~~p~~~~~~~~~~~a~~~g~g~~d~~a~~~~~~~  255 (257)
                      ++.+++++.|+|+|+++.+.+.|+.+.+.|+|++|+++|++++++
T Consensus        81 l~~~~a~~~~~~~p~~~~~~~~~~~a~~~G~~~~D~s~i~~~~~~  125 (133)
T d1vpda1          81 NALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSALACYYEK  125 (133)
T ss_dssp             HHHHHHHHHTCCCHHHHHHHHHHHHHHHTTCTTSBGGGHHHHHHH
T ss_pred             HHHHHHHHcCCCChHHHHHHHHHHHHHHcCCCCCCHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999986
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a1 a.100.1.8 (A:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1bg6a1 a.100.1.5 (A:188-359) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure