Citrus Sinensis ID: 025144


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MASLQLCLPFSSTSRSQFRFSYGRVRCSSERQELFSRIAPVYDNLNDLLSFGQHRIWKRMAVSWSGAKTGDNVLDVCCGSGDLSFLLSEQVGSQGKVIGLDFSKNQLSMASSRQDLVSKACYKNIEWVEGDALDLPFSDCFFDAITMGYGLRNVVDKRKALEESFRVLKPGSRISVLDFNKSTQPFTTAIQEWMIDNVVVPVASGYGLAEEYQYLKSSIREFLTGKDLEKLALEIGFSRAKHYELSGGLMGNLVATR
cccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcHHHHHcccccccEEEEccccccccccccccEEEEEccccccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHcHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHccccccEEECccccEEEEEEECc
*****************FRFSYGRVRCSSERQELFSRIAPVYDNLNDLLSFGQHRIWKRMAVSWSGAKTGDNVLDVCCGSGDLSFLLSEQVGSQGKVIGLDFSKNQLSMASSRQDLVSKACYKNIEWVEGDALDLPFSDCFFDAITMGYGLRNVVDKRKALEESFRVLKPGSRISVLDFNKSTQPFTTAIQEWMIDNVVVPVASGYGLAEEYQYLKSSIREFLTGKDLEKLALEIGFSRAKHYELSGGLMGNLVATR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLQLCLPFSSTSRSQFRFSYGRVRCSSERQELFSRIAPVYDNLNDLLSFGQHRIWKRMAVSWSGAKTGDNVLDVCCGSGDLSFLLSEQVGSQGKVIGLDFSKNQLSMASSRQDLVSKACYKNIEWVEGDALDLPFSDCFFDAITMGYGLRNVVDKRKALEESFRVLKPGSRISVLDFNKSTQPFTTAIQEWMIDNVVVPVASGYGLAEEYQYLKSSIREFLTGKDLEKLALEIGFSRAKHYELSGGLMGNLVATR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Demethylmenaquinone methyltransferase Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2).probableQ8DGE4
Demethylmenaquinone methyltransferase Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2).probableQ5N4X9
2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic Involved in the biosynthesis of phylloquinone (vitamin K1). Methyltransferase required for the conversion of 2-phytyl-1,4-beta-naphthoquinone to phylloquinone.probableQ3ED65

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BUS, chain A
Confidence level:very confident
Coverage over the Query: 45-197,217-246
View the alignment between query and template
View the model in PyMOL
Template: 3SM3, chain A
Confidence level:very confident
Coverage over the Query: 68-245
View the alignment between query and template
View the model in PyMOL