Citrus Sinensis ID: 025215

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------

MLSNLKVFVIALLLKIIMKRRFSIIQWEALALLLIGISVNQLRSLPEGTSALGLPVATGAYLYTLIFVTVPSLASVFNEYALKSQYDTSIYHQNLFLYGYGAIFNFLGIVITAMFKGPSSFDILQGHSKATMLLICNNAAQGILSSFFFKYADTILKKYSSTVATIFTGLASAALFGHTLTMNFILGISIVFISMHQFFSPLSKVKDEPKNISLESVDSPKNKRSKDTSFIGMAAGANEDASHRAVNEEKAPLLPI

ccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccc

MLSNLKVFVIALLLKIIMKRRFSIIQWEALALLLIGISVNQLRSLPEGTSALGLPVATGAYLYTLIFVTVPSLASVFNEYALKSQYDTSIYHQNLFLYGYGAIFNFLGIVITAMFKGPSSFDILQGHSKATMLLICNNAAQGILSSFFFKYADTILKKYSSTVATIFTGLASAALFGHTLTMNFILGISIVFISMHQFFSP*******************************************************

xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CMP-sialic acid transporter 2	Sugar transporter involved in the transport of CMP-sialic acid from the cytoplasm into the Golgi.	probable	Q8GY97

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 136-201
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 3-43
View the alignment between query and template
View the model in PyMOL