Citrus Sinensis ID: 025219

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MSWLLVIVSTIVVWVASLFKILNSSRSQSNAAFLTTGDKKNVLLVIAHPDDESMFFSPTINYLTSRRHNLHILCMSNGNADGMGNIRKDELHRACAVLKIPLEQVKVLDLVDFQDGFDKLWNHKSLAKIVEEEVVNCSIDLIITFDNYGVSGHCNHRDVHHGIWSYLNGTSERNIEAWELMTTNILRKYSGPLDIWLSILSATQYRRGQVHCLLNEHPKKSFLAMSQHHSQWVWFRKLFVSFSSYTYVNTLKRIND
cHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHccccccccHHHHHHHccccccccccHHHHHHHHHccccccccEEEcccccHHHHHHHHHcccccHHHHHHEEEEEEccEEEEccccccc
MSWLLVIVSTIVVWVASLFKILNSSR**SNAAFLTTGDKKNVLLVIAHPDDESMFFSPTINYLTSRRHNLHILCMSNGNADGMGNIRKDELHRACAVLKIPLEQVKVLDLVDFQDGFDKLWNHKSLAKIVEEEVVNCSIDLIITFDNYGVSGHCNHRDVHHGIWSYLNGTSERNIEAWELMTTNILRKYSGPLDIWLSILSATQYRRGQVHCLLNEHPKKSFLAMSQHHSQWVWFRKLFVSFSSYTYVNTLKRI**
xxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWLLVIVSTIVVWVASLFKILNSSRSQSNAAFLTTGDKKNVLLVIAHPDDESMFFSPTINYLTSRRHNLHILCMSNGNADGMGNIRKDELHRACAVLKIPLEQVKVLDLVDFQDGFDKLWNHKSLAKIVEEEVVNCSIDLIITFDNYGVSGHCNHRDVHHGIWSYLNGTSERNIEAWELMTTNILRKYSGPLDIWLSILSATQYRRGQVHCLLNEHPKKSFLAMSQHHSQWVWFRKLFVSFSSYTYVNTLKRIND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.probableQ9HDW9
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.probableQ9Y2B2
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.probableO35790

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q74, chain A
Confidence level:very confident
Coverage over the Query: 39-155
View the alignment between query and template
View the model in PyMOL
Template: 3DFF, chain A
Confidence level:very confident
Coverage over the Query: 40-234
View the alignment between query and template
View the model in PyMOL