Citrus Sinensis ID: 025237


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MKMKNGSVAMTLTVALVLALAVSLANGDESEKVIVKKLKGKKVCIKGWECPTWSKFCCNETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAASS
ccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccCCccccccHHHHHHHHcccccccccccECcccHHHHHHHHHccccCCccccccccccccccccccccccccccccc
*****GSVAMTLTVALVLALAVSLANGDESEKVIVKKLKGKKVCIKGWECPTWSKFCCNETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN**********
xxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMKNGSVAMTLTVALVLALAVSLANGDESEKVIVKKLKGKKVCIKGWECPTWSKFCCNETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAASS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chitinase-like protein 1 No chitinase activity. Essential for normal plant growth and development. Regulates cell expansion extent and differentiation at least in roots and hypocotyls. Prevents lignin accumulation in the pith. May modulate ethylene-mediated regulation during development. Probably required to establish thermotolerance acclimation. Plays a role for controlled anisotropic cell expansion in the regulation of waving during root gravitropism and thigmotropism. Involved in the root system architecture adaptation to multiple environmental conditions such as nitrate. Contributes to salt tolerance and possibly to drought by preventing the overaccumulation of sodium ions.probableQ9MA41

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CQL, chain A
Confidence level:very confident
Coverage over the Query: 61-246
View the alignment between query and template
View the model in PyMOL
Template: 2DKV, chain A
Confidence level:very confident
Coverage over the Query: 36-246
View the alignment between query and template
View the model in PyMOL