Citrus Sinensis ID: 025240


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSSGMKRTLSRYNKCLDFSEVAVAEYKTEKQDSKEVDGLKDEIAKLQMKQLRLLGKDLNGLSLKELQLLEQDLNEGLLLVKEKKEKLLMEQLEQSRVQEQRAMLENETLRRQVEELRGFFPPTECSVPAYLEYYPLGRKNSLMNHSSATPDVASDGAVEKGDSDTTLHLGLPSNLYHKRKAPERETNSNDSRSQLGVL
ccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSSGMKRTLSRYNKCLDFSEVAVAEY********EVDGLKDEIAKLQMKQLRLLGKDLNGLSLKELQLLEQDLNEGLLLVKEKKEKLLMEQLEQSRVQEQRAMLENETLRRQVEELRGFF*********************************************TLHLGL***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSSGMKRTLSRYNKCLDFSEVAVAEYKTxxxxxxxxxxxxxxxxxxxxxQLRLLGKDLNGLSLKELQLLEQDLNEGLLLVKEKKEKLLMEQxxxxxxxxxxxxxxxxxxxxxVEELRGFFPPTECSVPAYLEYYPLGRKNSLMNHSSATPDVASDGAVEKGDSDTTLHLGLPSNLYHKRKAPERETNSNDSRSQLGVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Agamous-like MADS-box protein AGL15 Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro.probableQ38847
MADS-box transcription factor 6 Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time.probableQ6EU39
Agamous-like MADS-box protein AGL15 Probable transcription factor.probableQ39295

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL
Template: 2W6A, chain A
Confidence level:probable
Coverage over the Query: 116-168
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 14-71
View the alignment between query and template
View the model in PyMOL