Citrus Sinensis ID: 025243

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----

MRQPTKVKSCLAVVFTVCSLVAMKLFVKNHDYFFVASEAIHAAGIMVLIYKLTTKNTCSGLSLKTQELTAMFLALRLVCSIIMEADIHTVLDFATLASTAWVIYMIRFKLKSTYIKELDNFPIYYIAVPSAILAFIVHPSNRLINLSGILWAFCVYVESVSVLPQLRLMQNAKMIEPFTSHYVFALGVARFLSFAHWILQLIETRGRYLFLLGHGYLWFPVAFLAEMIQTFILADFCYYYIKSLKEGQLLMRMPI

ccccccHHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccccccccHHHHHHHHHHHHHEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc

******V*SCLAVVFTVCSLVAMKLFVKNHDYFFVASEAIHAAGIMVLIYKLTTKNTCSGLSLKTQELTAMFLALRLVCSIIMEADIHTVLDFATLASTAWVIYMIRFKLKSTYIKELDNFPIYYIAVPSAILAFIVHPSNRLINLSGILWAFCVYVESVSVLPQLRLMQNAKMIEPFTSHYVFALGVARFLSFAHWILQLIETRGRYLFLLGHGYLWFPVAFLAEMIQTFILADFCYYYIKSLKEGQLLMRMPI

xxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ER lumen protein retaining receptor	Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi.	probable	O94270

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted