Citrus Sinensis ID: 025260


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYSVYAATKAYIDQFSRSLYVEYRKSGIDVQCQVLFLLCFYNLNDLVMIQSS
cccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEECccHHHHHHHHHHHHHHHccEEEEEEEEccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccc
***CFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYSVYAATKAYIDQFSRSLYVEYRKSGIDVQCQVLFLLCFYNLNDLVM****
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYSVYAATKAYIDQFSRSLYVEYRKSGIDVQCQVLFLLCFYNLNDLVMIQSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Very-long-chain 3-oxoacyl-CoA reductase 1 Beta-ketoacyl-coenzyme A reductase required for the elongation of fatty acids precursors of sphingolipids, triacylglycerols, cuticular waxes and suberin. Responsible for the first reduction step in very long-chain fatty acids (VLCFAs) synthesis. Decreased expression of KCR1 (RNAi) leads to plants with fused vegetative and reproductive organs, and abnormal trichome, epidermal cell and root morphology. Cannot be complemented by KCR2.probableQ8L9C4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 50-245
View the alignment between query and template
View the model in PyMOL