Citrus Sinensis ID: 025270


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MEFNYAKFKALFRTNNNFRLQRPVADWAKSSGVKQFLFISSAGIYKPADEPPHVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPIPGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPVEIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGRDKKAMQFEIDDKILESLKVPIPV
cccccccccEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHcccccccccccccEEEEEEHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHccccccEEEccccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccc
***NYAKFKALFRTNNNFRLQRPVADWAKSSGVKQFLFISSAGIYKPADEPPHVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPIPGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPVEIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGRDKKAMQFEIDDKILESLKVP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFNYAKFKALFRTNNNFRLQRPVADWAKSSGVKQFLFISSAGIYKPADEPPHVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPIPGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPVEIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGRDKKAMQFEIDDKILESLKVPIPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic Binds and cleaves RNA, particularly in stem-loops. Associates with pre-ribosomal particles in chloroplasts, and participates in chloroplast ribosomal RNA metabolism, probably during the final steps of 23S rRNA maturation. May enhance transcription by the plastid-encoded polymerase and translation in plastid via the stabilization of ribosome assembly intermediates. Required for chloroplast integrity. Involved in the regulation of the circadian system.probableQ9LYA9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KO8, chain A
Confidence level:very confident
Coverage over the Query: 8-177,192-232
View the alignment between query and template
View the model in PyMOL
Template: 2Q1S, chain A
Confidence level:confident
Coverage over the Query: 18-42,55-182,193-250
View the alignment between query and template
View the model in PyMOL