Citrus Sinensis ID: 025281


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MIKRKSNARGKMHESSTTTSSTSTEDEIDCELRPGGMLVQKRSEKTDVPAPYLRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIYRGKERENGEYLDMCRVKDRSKVILTEDPASIERRFIEMRRNAKIQSAHRAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQITTLIEMLMRQAIKLDSISAEGDASAQKKLQGKRVQKCVETLDLLKIANVKVQPVVVTTKWETFDPPPSTVHWEIFD
ccccccccccccccccccccccccccccccccccccEEEEECccccccccccEEEEEEEccEEEEEEEcccccHHHHHHHHHHHccccccccEEEEccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccc
*********************************PGG***********VPAPYLRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIYRGKERENGEYLDMCRVKDRSKVILTEDPASIERRFIEMRRNAKI***HRAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQITTLIEMLMRQAIKLDSISAEG*A*A*****GKRVQKCVETLDLLKIANVKVQPVVVTTKWETFDPPPSTVHWEIFD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKRKSNARGKMHESSTTTSSTSTEDEIDCELRPGGMLVQKRSEKTDVPAPYLRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIYRGKERENGEYLDMCRVKDRSKVILTEDPASIERRFIEMRRNAKIQSAHRAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQITTLIEMLMRQAIKLDSISAEGDASAQKKLQGKRVQKCVETLDLLKIANVKVQPVVVTTKWETFDPPPSTVHWEIFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BAG family molecular chaperone regulator 2 Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.probableQ0WPX7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A8Y, chain C
Confidence level:confident
Coverage over the Query: 143-228
View the alignment between query and template
View the model in PyMOL
Template: 2KD0, chain A
Confidence level:confident
Coverage over the Query: 50-125
View the alignment between query and template
View the model in PyMOL
Template: 1I6Z, chain A
Confidence level:confident
Coverage over the Query: 114-226
View the alignment between query and template
View the model in PyMOL
Template: 1WJ4, chain A
Confidence level:probable
Coverage over the Query: 14-122
View the alignment between query and template
View the model in PyMOL