Citrus Sinensis ID: 025281
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 255 | ||||||
| 225443974 | 256 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.996 | 0.773 | 1e-108 | |
| 356555510 | 251 | PREDICTED: uncharacterized protein LOC10 | 0.984 | 1.0 | 0.717 | 1e-103 | |
| 297740785 | 219 | unnamed protein product [Vitis vinifera] | 0.858 | 1.0 | 0.821 | 1e-101 | |
| 356549122 | 253 | PREDICTED: uncharacterized protein LOC10 | 0.988 | 0.996 | 0.699 | 2e-97 | |
| 224061055 | 241 | predicted protein [Populus trichocarpa] | 0.933 | 0.987 | 0.737 | 1e-96 | |
| 255580463 | 296 | conserved hypothetical protein [Ricinus | 0.909 | 0.783 | 0.746 | 2e-95 | |
| 449435872 | 324 | PREDICTED: BAG family molecular chaperon | 0.901 | 0.709 | 0.696 | 3e-91 | |
| 147809934 | 319 | hypothetical protein VITISV_016805 [Viti | 0.898 | 0.717 | 0.766 | 3e-90 | |
| 414585402 | 268 | TPA: hypothetical protein ZEAMMB73_38745 | 0.905 | 0.861 | 0.569 | 1e-73 | |
| 115460606 | 272 | Os04g0619900 [Oryza sativa Japonica Grou | 0.878 | 0.823 | 0.569 | 3e-73 |
| >gi|225443974|ref|XP_002280537.1| PREDICTED: uncharacterized protein LOC100266950 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 397 bits (1019), Expect = e-108, Method: Compositional matrix adjust.
Identities = 198/256 (77%), Positives = 228/256 (89%), Gaps = 1/256 (0%)
Query: 1 MIKRKSNARGKMHESSTTTSSTSTEDE-IDCELRPGGMLVQKRSEKTDVPAPYLRLRIAF 59
M+K +S+ G M E S TT+S++++DE I+ E+RPGGMLVQKR+EK+D AP L +R+A+
Sbjct: 1 MMKGRSDYSGCMSEGSATTTSSTSKDEEIEWEMRPGGMLVQKRTEKSDSLAPNLLIRVAY 60
Query: 60 GALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIYRGKERENGEYLDMCRVKDRSKVI 119
GALRYEISVNS+ATFGE+KK+LT ETGLQ G+Q LI+RGKERENG+YLDMC VK RSKVI
Sbjct: 61 GALRYEISVNSQATFGELKKLLTAETGLQPGEQRLIFRGKERENGDYLDMCGVKGRSKVI 120
Query: 120 LTEDPASIERRFIEMRRNAKIQSAHRAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQI 179
L EDP+S ERR IEMRRNAKIQ+AHRAIS+VSMEVDKL EQVSAIEKSISNG KVPEVQI
Sbjct: 121 LMEDPSSRERRAIEMRRNAKIQTAHRAISDVSMEVDKLAEQVSAIEKSISNGTKVPEVQI 180
Query: 180 TTLIEMLMRQAIKLDSISAEGDASAQKKLQGKRVQKCVETLDLLKIANVKVQPVVVTTKW 239
TTLIEMLMRQAIKLD I+AEGDASAQK LQGKRVQKCVETLD+LKI+N KV+PV+VTTKW
Sbjct: 181 TTLIEMLMRQAIKLDGIAAEGDASAQKNLQGKRVQKCVETLDVLKISNGKVKPVIVTTKW 240
Query: 240 ETFDPPPSTVHWEIFD 255
ETFDPPP+T HWE FD
Sbjct: 241 ETFDPPPTTAHWEFFD 256
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356555510|ref|XP_003546074.1| PREDICTED: uncharacterized protein LOC100800682 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297740785|emb|CBI30967.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356549122|ref|XP_003542946.1| PREDICTED: uncharacterized protein LOC100796062 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224061055|ref|XP_002300336.1| predicted protein [Populus trichocarpa] gi|222847594|gb|EEE85141.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255580463|ref|XP_002531057.1| conserved hypothetical protein [Ricinus communis] gi|223529352|gb|EEF31318.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449435872|ref|XP_004135718.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147809934|emb|CAN67094.1| hypothetical protein VITISV_016805 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|414585402|tpg|DAA35973.1| TPA: hypothetical protein ZEAMMB73_387459 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|115460606|ref|NP_001053903.1| Os04g0619900 [Oryza sativa Japonica Group] gi|38344334|emb|CAD41750.2| OSJNBa0058K23.16 [Oryza sativa Japonica Group] gi|113565474|dbj|BAF15817.1| Os04g0619900 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 255 | ||||||
| TAIR|locus:2173108 | 342 | BAG1 "BCL-2-associated athanog | 0.780 | 0.581 | 0.517 | 5.4e-53 | |
| TAIR|locus:2182900 | 303 | BAG3 "BCL-2-associated athanog | 0.768 | 0.646 | 0.484 | 2.6e-47 | |
| TAIR|locus:2074353 | 269 | BAG4 "BCL-2-associated athanog | 0.858 | 0.814 | 0.353 | 4.2e-31 | |
| TAIR|locus:2168788 | 165 | AT5G40630 "AT5G40630" [Arabido | 0.501 | 0.775 | 0.392 | 2.5e-19 | |
| TAIR|locus:2145683 | 163 | AT5G14360 "AT5G14360" [Arabido | 0.415 | 0.650 | 0.435 | 8.3e-19 |
| TAIR|locus:2173108 BAG1 "BCL-2-associated athanogene 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 521 (188.5 bits), Expect = 5.4e-53, Sum P(2) = 5.4e-53
Identities = 105/203 (51%), Positives = 148/203 (72%)
Query: 29 DCELRPGGMLVQKRSEKTDV----PAPYLRLRIAFGALRYEISVNSRATFGEVKKVLTGE 84
D E+RPGGMLVQKR+ D P P +R+RI +GA+ +EI+++ +A+FGE+KK+LTG
Sbjct: 39 DLEIRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGAVYHEINISPQASFGELKKMLTGP 98
Query: 85 TGLQAGDQVLIYRGKERENGEYLDMCRVKDRSKVILTEDPASIERRFIEMRRNAKIQSAH 144
TG+ DQ L+Y+ KER++ +LD+ VKD+SK++L EDP S E+RF+EMR+ AK + A
Sbjct: 99 TGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKAS 158
Query: 145 RAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQITTLIEMLMRQAIKLDSISAEGDASA 204
+AIS++S+EVD+L +VSA E G K+ E + T+IE+LM + IKLD+I AEGD
Sbjct: 159 KAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKL 218
Query: 205 QKKLQGKRVQKCVETLDLLKIAN 227
Q+K+Q KRVQ VETLD LK+ N
Sbjct: 219 QRKMQVKRVQNYVETLDALKVKN 241
|
|
| TAIR|locus:2182900 BAG3 "BCL-2-associated athanogene 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074353 BAG4 "BCL-2-associated athanogene 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168788 AT5G40630 "AT5G40630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145683 AT5G14360 "AT5G14360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 255 | |||
| cd01812 | 71 | cd01812, BAG1_N, Ubiquitin-like domain of BAG1 | 8e-24 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 6e-11 | |
| pfam02179 | 76 | pfam02179, BAG, BAG domain | 4e-07 | |
| cd00196 | 69 | cd00196, UBQ, Ubiquitin-like proteins | 3e-05 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 7e-04 |
| >gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
Score = 90.8 bits (226), Expect = 8e-24
Identities = 35/71 (49%), Positives = 54/71 (76%)
Query: 53 LRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIYRGKERENGEYLDMCRV 112
+R+R+ G +++S++S+ATFG++KK+L TG++ DQ LI++GKER++ E LDM V
Sbjct: 1 IRVRVKHGGESHDLSISSQATFGDLKKMLAPVTGVEPRDQKLIFKGKERDDAETLDMSGV 60
Query: 113 KDRSKVILTED 123
KD SKV+L ED
Sbjct: 61 KDGSKVMLLED 71
|
BAG1_N N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein. This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP). Length = 71 |
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|216918 pfam02179, BAG, BAG domain | Back alignment and domain information |
|---|
| >gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 255 | |||
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.82 | |
| KOG4361 | 344 | consensus BCL2-associated athanogene-like proteins | 99.81 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.76 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.67 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.67 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.64 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.63 | |
| PF02179 | 76 | BAG: BAG domain; InterPro: IPR003103 BAG domains a | 99.62 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.62 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.62 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.61 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.61 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.6 | |
| smart00264 | 79 | BAG BAG domains, present in regulator of Hsp70 pro | 99.6 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.59 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.59 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.59 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.57 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.57 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.56 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.56 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.55 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.55 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.54 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.53 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.5 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 99.38 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.37 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 99.36 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.35 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 99.29 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 99.28 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 99.27 | |
| KOG1872 | 473 | consensus Ubiquitin-specific protease [Posttransla | 99.25 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.23 | |
| KOG0005 | 70 | consensus Ubiquitin-like protein [Cell cycle contr | 99.09 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 99.09 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.01 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 98.97 | |
| KOG0004 | 156 | consensus Ubiquitin/40S ribosomal protein S27a fus | 98.85 | |
| KOG0003 | 128 | consensus Ubiquitin/60s ribosomal protein L40 fusi | 98.75 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 98.74 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 98.67 | |
| PLN02560 | 308 | enoyl-CoA reductase | 98.56 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 98.52 | |
| KOG0001 | 75 | consensus Ubiquitin and ubiquitin-like proteins [P | 98.48 | |
| KOG4248 | 1143 | consensus Ubiquitin-like protein, regulator of apo | 98.48 | |
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.47 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 98.38 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 98.03 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 97.82 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 97.59 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 97.35 | |
| KOG3206 | 234 | consensus Alpha-tubulin folding cofactor B [Posttr | 97.22 | |
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 96.95 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 96.92 | |
| smart00666 | 81 | PB1 PB1 domain. Phox and Bem1p domain, present in | 96.66 | |
| KOG4495 | 110 | consensus RNA polymerase II transcription elongati | 96.65 | |
| KOG3493 | 73 | consensus Ubiquitin-like protein [Posttranslationa | 96.5 | |
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 96.16 | |
| COG5417 | 81 | Uncharacterized small protein [Function unknown] | 96.13 | |
| PF00564 | 84 | PB1: PB1 domain; InterPro: IPR000270 The Phox and | 96.11 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 96.0 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 95.64 | |
| KOG0013 | 231 | consensus Uncharacterized conserved protein [Funct | 95.59 | |
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 95.32 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 95.27 | |
| KOG4361 | 344 | consensus BCL2-associated athanogene-like proteins | 95.22 | |
| cd06407 | 82 | PB1_NLP A PB1 domain is present in NIN like protei | 95.03 | |
| cd05992 | 81 | PB1 The PB1 domain is a modular domain mediating s | 94.88 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 94.61 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 93.84 | |
| cd06396 | 81 | PB1_NBR1 The PB1 domain is an essential part of NB | 92.98 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 92.89 | |
| cd06408 | 86 | PB1_NoxR The PB1 domain is present in the Epichloe | 92.76 | |
| KOG4583 | 391 | consensus Membrane-associated ER protein involved | 92.12 | |
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 91.56 | |
| cd06398 | 91 | PB1_Joka2 The PB1 domain is present in the Nicotia | 90.85 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 90.51 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 90.32 | |
| PF14836 | 88 | Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A | 89.39 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 88.83 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 88.24 | |
| cd06411 | 78 | PB1_p51 The PB1 domain is present in the p51 prote | 88.05 | |
| cd06397 | 82 | PB1_UP1 Uncharacterized protein 1. The PB1 domain | 86.07 | |
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 84.88 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 84.75 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 84.69 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 82.69 | |
| KOG1639 | 297 | consensus Steroid reductase required for elongatio | 82.64 | |
| TIGR02958 | 452 | sec_mycoba_snm4 secretion protein snm4. Members of | 81.05 |
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
Probab=99.82 E-value=4.8e-20 Score=138.46 Aligned_cols=71 Identities=20% Similarity=0.361 Sum_probs=68.7
Q ss_pred EEEEEEeCCEEEEEEEcCCCCHHHHHHHHHHhcCCCCCceeEEe---cCeecCCccchhhcCCCCCcEEEEecC
Q 025281 53 LRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIY---RGKERENGEYLDMCRVKDRSKVILTED 123 (255)
Q Consensus 53 I~V~Vk~g~~~~~I~v~~~sTvgdLK~~l~~~TGVpp~~QKLiy---KGK~ldD~~~L~~~GVkdgSkImLv~~ 123 (255)
|+|+|||++++|+|+|++++|+++||++|++.|||||++||||| +|+.++|+.+|+.|||++|++|||||+
T Consensus 1 ~~i~vk~~g~~~~v~v~~~~Tv~~lK~~i~~~tgvp~~~QKLi~~~~~Gk~l~D~~~L~~~~i~~g~~i~lmGs 74 (74)
T cd01813 1 VPVIVKWGGQEYSVTTLSEDTVLDLKQFIKTLTGVLPERQKLLGLKVKGKPAEDDVKISALKLKPNTKIMMMGT 74 (74)
T ss_pred CEEEEEECCEEEEEEECCCCCHHHHHHHHHHHHCCCHHHEEEEeecccCCcCCCCcCHHHcCCCCCCEEEEEeC
Confidence 68999999999999999999999999999999999999999997 999999999999999999999999984
|
The UBP (ubiquitin processing protease) domain (also referred to as USP which stands for "ubiquitin-specific protease") is present at in a large family of cysteine proteases that specifically cleave ubiquitin conjugates. This family includes Rpn11, UBP6 (USP14), USP7 (HAUSP). This domain is closely related to the amino-terminal ubiquitin-like domain of BAG1 (Bcl2-associated anthanogene1) protein and is found only in eukaryotes. |
| >KOG4361 consensus BCL2-associated athanogene-like proteins and related BAG family chaperone regulators [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >PF02179 BAG: BAG domain; InterPro: IPR003103 BAG domains are present in Bcl-2-associated athanogene 1 and silencer of death domains | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >smart00264 BAG BAG domains, present in regulator of Hsp70 proteins | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >smart00666 PB1 PB1 domain | Back alignment and domain information |
|---|
| >KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] | Back alignment and domain information |
|---|
| >KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >COG5417 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >KOG0013 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >KOG4361 consensus BCL2-associated athanogene-like proteins and related BAG family chaperone regulators [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) | Back alignment and domain information |
|---|
| >cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA | Back alignment and domain information |
|---|
| >KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein | Back alignment and domain information |
|---|
| >cd06397 PB1_UP1 Uncharacterized protein 1 | Back alignment and domain information |
|---|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02958 sec_mycoba_snm4 secretion protein snm4 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 255 | |||
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 2e-08 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 4e-08 | |
| 1m62_A | 87 | BAG-family molecular chaperone regulator-4; BAG do | 3e-07 | |
| 3a8y_C | 142 | BAG family molecular chaperone regulator 5; BAG do | 1e-06 | |
| 1m7k_A | 99 | Silencer of death domains; three helix bundle, cha | 3e-06 | |
| 1uk5_A | 111 | BAG-family molecular chaperone regulator-3; triple | 5e-06 | |
| 1ugo_A | 99 | BCL2-associated athanogene 5; triple helix bundle, | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 2e-04 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 3e-04 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 3e-04 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 3e-04 | |
| 3u5c_F | 225 | RP14, S2, YS8, 40S ribosomal protein S5; translati | 3e-04 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 3e-04 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 4e-04 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 5e-04 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 7e-04 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 8e-04 |
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
Score = 49.8 bits (119), Expect = 2e-08
Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
Query: 36 GMLVQKRSEKTDVPAPYLRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLI 95
G V + L+I + ++++ V +T E+K+ + TGL Q ++
Sbjct: 1 GSSGSSGDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLPPAMQKVM 60
Query: 96 YRGKERENGEYLDMCRVKDRSKVIL 120
Y+G E+ + L +V +K+++
Sbjct: 61 YKGLVPED-KTLREIKVTSGAKIMV 84
|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 | Back alignment and structure |
|---|
| >1m62_A BAG-family molecular chaperone regulator-4; BAG domain, SODD, silencer of death domains, HSP70/HSC70 CO-chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 Length = 87 | Back alignment and structure |
|---|
| >3a8y_C BAG family molecular chaperone regulator 5; BAG domain, HSP70, ATPase domain, protein complex, triple helix, structural genomics, NPPSFA; 2.30A {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >1m7k_A Silencer of death domains; three helix bundle, chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 Length = 99 | Back alignment and structure |
|---|
| >1uk5_A BAG-family molecular chaperone regulator-3; triple helix bandle, CAIR-1, BIS, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.7.7.1 Length = 111 | Back alignment and structure |
|---|
| >1ugo_A BCL2-associated athanogene 5; triple helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics, chaperone; NMR {Mus musculus} SCOP: a.7.7.1 Length = 99 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 | Back alignment and structure |
|---|
| >3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 255 | |||
| 1m62_A | 87 | BAG-family molecular chaperone regulator-4; BAG do | 99.83 | |
| 1uk5_A | 111 | BAG-family molecular chaperone regulator-3; triple | 99.81 | |
| 1m7k_A | 99 | Silencer of death domains; three helix bundle, cha | 99.8 | |
| 3a8y_C | 142 | BAG family molecular chaperone regulator 5; BAG do | 99.8 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.8 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.8 | |
| 1ugo_A | 99 | BCL2-associated athanogene 5; triple helix bundle, | 99.79 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.79 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.76 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.75 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.75 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.74 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.74 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.72 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.71 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.71 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.7 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.7 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.69 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.69 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.69 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.68 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.68 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.67 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.67 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.67 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.67 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.67 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.67 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.67 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.67 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.66 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.66 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.66 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.66 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.66 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.66 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.66 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.65 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.65 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.65 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.65 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.64 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.64 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.64 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.64 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.64 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.63 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.63 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.63 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.63 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.63 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.62 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.61 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.6 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.6 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.6 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.59 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.59 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.59 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.59 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.59 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.59 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.58 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.58 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.57 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 99.34 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.55 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.55 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.55 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.54 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.53 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.52 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.52 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.51 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.5 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.5 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.5 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.49 | |
| 1i6z_A | 135 | BAG-family molecular chaperone regulator-1; triple | 99.48 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.47 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.47 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.46 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.46 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.45 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.39 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 99.39 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.37 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.36 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.36 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.35 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 99.33 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 99.3 | |
| 1t7s_A | 137 | BAG-1 cochaperone; structural genomics, PSI, prote | 99.21 | |
| 1hx1_B | 114 | BAG-1, BAG-family molecular chaperone regulator-1; | 99.21 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.05 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 99.03 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 98.99 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 98.99 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 98.97 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 98.89 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 98.84 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 98.8 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 98.79 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 98.41 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 98.37 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 98.31 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 98.27 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 98.25 | |
| 2d9d_A | 89 | BAG family molecular chaperone regulator 5; triple | 97.93 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 97.84 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 97.74 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 97.73 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 97.58 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 97.52 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 97.4 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 97.4 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 97.21 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 97.17 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 97.08 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 96.93 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 96.84 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 96.04 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 95.49 | |
| 1vd2_A | 89 | Protein kinase C, IOTA type; PB1 domain, OPCA moti | 94.69 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 94.25 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 94.11 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 94.09 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 93.58 | |
| 1ip9_A | 85 | BEM1 protein; ubiquitin alpha/beta roll, signaling | 93.06 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 93.02 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 91.33 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 91.22 | |
| 1q1o_A | 98 | Cell division control protein 24; PB1 domain, PCCR | 91.1 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 86.95 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 86.35 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 85.59 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 83.36 | |
| 1wj6_A | 101 | KIAA0049 protein, RSGI RUH-024; PB1 domain, protei | 80.57 |
| >1m62_A BAG-family molecular chaperone regulator-4; BAG domain, SODD, silencer of death domains, HSP70/HSC70 CO-chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 | Back alignment and structure |
|---|
Probab=99.83 E-value=1.7e-20 Score=144.86 Aligned_cols=74 Identities=24% Similarity=0.289 Sum_probs=70.1
Q ss_pred HHHhhhhhhHHHHHHHHHHHHHhhhccCCCCcchhhHhHHHHHHHHHHHHccCccccch--hhHHHHHHHHHHHHHHHHH
Q 025281 143 AHRAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQITTLIEMLMRQAIKLDSISAEGD--ASAQKKLQGKRVQKCVETL 220 (255)
Q Consensus 143 a~~ais~v~~eVdkLa~~v~a~e~~v~~g~kv~e~e~~~LsE~LM~qLLKLD~I~aeGd--~R~qRK~~VkrVQ~~le~L 220 (255)
++++|++|+.+|++|+++|.+|+ +++.|++|..|+|+||++|||||+|+++|+ +|.+||.+|++||++|+.|
T Consensus 9 a~~~I~~I~~ev~~L~~~V~~f~------g~~~dkey~~L~E~L~k~LLkLD~Ie~eG~~~~R~~RK~~Vk~iQ~~l~~L 82 (87)
T 1m62_A 9 SIKKIIHVLEKVQYLEQEVEEFV------GKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKL 82 (87)
T ss_dssp THHHHHHHHHHHHHHHHHHHHCC------CCTTSHHHHHHHHHHHHHHHHHTTCCCSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHh------CCcchHHHHHHHHHHHHHHHHHCCcCcCCcHHHHHHHHHHHHHHHHHHHHH
Confidence 67889999999999999999995 358999999999999999999999999995 9999999999999999999
Q ss_pred hH
Q 025281 221 DL 222 (255)
Q Consensus 221 D~ 222 (255)
|.
T Consensus 83 D~ 84 (87)
T 1m62_A 83 EK 84 (87)
T ss_dssp HH
T ss_pred Hh
Confidence 97
|
| >1uk5_A BAG-family molecular chaperone regulator-3; triple helix bandle, CAIR-1, BIS, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1m7k_A Silencer of death domains; three helix bundle, chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >3a8y_C BAG family molecular chaperone regulator 5; BAG domain, HSP70, ATPase domain, protein complex, triple helix, structural genomics, NPPSFA; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >1ugo_A BCL2-associated athanogene 5; triple helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics, chaperone; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >1i6z_A BAG-family molecular chaperone regulator-1; triple helix bundle; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1t7s_A BAG-1 cochaperone; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.80A {Caenorhabditis elegans} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1hx1_B BAG-1, BAG-family molecular chaperone regulator-1; protein-protein complex, apoptosis, protein folding, molecul chaperone; 1.90A {Homo sapiens} SCOP: a.7.7.1 PDB: 3fzf_B* 3fzh_B* 3fzk_B* 3fzl_B* 3fzm_B* 3ldq_B* 3m3z_B* | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d9d_A BAG family molecular chaperone regulator 5; triple helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >1wj6_A KIAA0049 protein, RSGI RUH-024; PB1 domain, protein binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 255 | ||||
| d1ugoa_ | 99 | a.7.7.1 (A:) BAG-family molecular chaperone regula | 2e-13 | |
| d1uk5a_ | 111 | a.7.7.1 (A:) BAG-family molecular chaperone regula | 1e-11 | |
| d1m7ka_ | 81 | a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4 | 2e-11 | |
| d2bwfa1 | 73 | d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc | 3e-06 | |
| d1wxva1 | 81 | d.15.1.1 (A:7-87) Bag-family molecular chaperone r | 2e-05 | |
| d1v86a_ | 95 | d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous | 2e-05 | |
| d1j8ca_ | 103 | d.15.1.1 (A:) Ubiquitin-like N-terminal domain of | 2e-04 | |
| d1wx8a1 | 83 | d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul | 3e-04 | |
| d1zkha1 | 86 | d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t | 6e-04 | |
| d1oqya4 | 77 | d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h | 0.002 | |
| d1wjua_ | 100 | d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human | 0.002 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 0.002 | |
| d1yqba1 | 84 | d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien | 0.003 |
| >d1ugoa_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Spectrin repeat-like superfamily: BAG domain family: BAG domain domain: BAG-family molecular chaperone regulator-5, BAG-5 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 62.5 bits (152), Expect = 2e-13
Identities = 14/82 (17%), Positives = 31/82 (37%), Gaps = 8/82 (9%)
Query: 143 AHRAISNVSMEVDKLVEQVSAIEKSISNGVKVPEVQITTLIEMLMRQAIKLDSISAEGDA 202
+ + + EV + QV + L +L +Q ++DS+ EG
Sbjct: 16 SISRLQEIQREVKAIEPQVVGFSG------LSDDKNYKRLERILTKQLFEIDSVDTEGKG 69
Query: 203 SAQK--KLQGKRVQKCVETLDL 222
Q+ K + ++ ++ L+
Sbjct: 70 DIQQARKRAAQETERLLKELEQ 91
|
| >d1uk5a_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1m7ka_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 255 | |||
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.81 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.8 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.8 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.79 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.79 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.78 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.78 | |
| d1ugoa_ | 99 | BAG-family molecular chaperone regulator-5, BAG-5 | 99.74 | |
| d1m7ka_ | 81 | Silencer of death domains, Sodd (Bag4) {Human (Hom | 99.74 | |
| d1uk5a_ | 111 | BAG-family molecular chaperone regulator-3 {Mouse | 99.72 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.72 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.71 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.7 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.7 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.69 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.69 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.68 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.68 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.67 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.67 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.67 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.66 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.63 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.61 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.58 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.57 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.56 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.56 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.54 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.53 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.52 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.49 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.45 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.44 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.41 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.4 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.23 | |
| d1t7sa_ | 129 | BAG-family molecular chaperon regulator-1, BAG1 {N | 99.16 | |
| d1hx1b_ | 112 | BAG-family molecular chaperon regulator-1, BAG1 {H | 99.07 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 99.0 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 98.19 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.09 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 96.7 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 96.42 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.64 | |
| d1ip9a_ | 85 | Bud emergence mediator Bemp1 {Baker's yeast (Sacch | 95.56 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 95.33 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 95.21 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 94.08 | |
| d2bkfa1 | 85 | Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum | 93.63 | |
| d1oeya_ | 82 | Neutrophil cytosol factor 2 (p67phox component of | 89.53 | |
| d1xo3a_ | 101 | C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 | 84.22 | |
| d1wmha_ | 83 | Protein kinase C, iota type {Human (Homo sapiens) | 80.69 |
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: DSK2 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.81 E-value=3.9e-20 Score=134.97 Aligned_cols=72 Identities=24% Similarity=0.420 Sum_probs=69.6
Q ss_pred cEEEEEEeCCEEEEEEEcCCCCHHHHHHHHHHhcCCCCCceeEEecCeecCCccchhhcCCCCCcEEEEecC
Q 025281 52 YLRLRIAFGALRYEISVNSRATFGEVKKVLTGETGLQAGDQVLIYRGKERENGEYLDMCRVKDRSKVILTED 123 (255)
Q Consensus 52 ~I~V~Vk~g~~~~~I~v~~~sTvgdLK~~l~~~TGVpp~~QKLiyKGK~ldD~~~L~~~GVkdgSkImLv~~ 123 (255)
+|+|+|++++.+|+|+|+++.||.+||+.|+..+|+||+.|||||+|+.|+|+.+|+.|||++|++||||..
T Consensus 1 si~I~Vk~~~~~~~i~v~~~~tV~~lK~~I~~~~gip~~~qrLi~~Gk~L~D~~tL~~~~I~~g~~i~lV~~ 72 (73)
T d2bwfa1 1 SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKS 72 (73)
T ss_dssp EEEEEEEETTEEEEEEECTTCBHHHHHHHHHHHHCCCGGGEEEEETTEECCTTSBTGGGTCCTTCEEEEEEC
T ss_pred CEEEEEEeCCeEEEEEECCCChHHHHHHHHHHHHCcChHHeEEEECCeEccCCCcHHHCCCCCCCEEEEEee
Confidence 589999999999999999999999999999999999999999999999999999999999999999999863
|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugoa_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ka_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uk5a_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hx1b_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmha_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|