Citrus Sinensis ID: 025315


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MPLTTANFSICPSIFLRRIRVRSPSPKFPPRFSQFSISRPNLTSPSAAMLLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFADVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGSRHQVSSAMGKQKKISSSAEAE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccc
***T*ANFSICPSIFLRRIRV*********************TSPSAAMLLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFADVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGSRHQVSSAMGKQKKISSSAEA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLTTANFSICPSIFLRRIRVRSPSPKFPPRFSQFSISRPNLTSPSAAMLLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFADVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGSRHQVSSAMGKQKKISSSAEAE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable phytol kinase 2, chloroplastic Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytolmonophosphate (PMP).probableQ67ZM7
Probable phytol kinase 3, chloroplastic Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytolmonophosphate (PMP).probableQ2N2K0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!