Citrus Sinensis ID: 025343


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MSSVFSSKSNHMYLNKSKAQEQKSRKAQMGFNVLKTSPVSCSSRTFSSVLSNLNFIHSPTTTRLFTNRLNSLAPSLLKLKPLTVTGTGCISSSGFYRSLRFEQNKRSFRGGVVLAVASGPASVNKSEEEWRAILSPEQFRILRQKATEYPGTGEYDKHFEEGIYNCSACGTPLYKSTTKFNSGCGWPAFYEGLPGAINCSPDPDGLRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKFVPANSGSSM
cccccccccccCECcHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccEEEEEEccccccccccccccccHHccccccccccccccHHHcccccccccccHHHcccccccccccHHHHHHHccHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEcccccccccEEEccccccccccccccccccccccccccccccccEEECccccccc
*********************************LKTSPVSCSSRTFSSVLSNLNFIHSPTTTRLFTNRLNSLAPSLLKLKPLTVTGTGCISSSGFYRSLRFEQNKRSFRGGVVLAVAS**********EWRAILSPEQFRILRQKATEYPGTGEYDKHFEEGIYNCSACGTPLYKSTTKFNSGCGWPAFYEGLPGAINCSPDPDGLRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKF*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSVFSSKSNHMYLNKSKAQEQKSRKAQMGFNVLKTSPVSCSSRTFSSVLSNLNFIHSPTTTRLFTNRLNSLAPSLLKLKPLTVTGTGCISSSGFYRSLRFEQNKRSFRGGVVLAVASGPASVNKSEEEWRAILSPEQFRILRQKATEYPGTGEYDKHFEEGIYNCSACGTPLYKSTTKFNSGCGWPAFYEGLPGAINCSPDPDGLRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKFVPANSGSSM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide methionine sulfoxide reductase B3, chloroplastic Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer.probableQ6AUK5
Peptide methionine sulfoxide reductase B2, chloroplastic Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.probableQ9C5C8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.4.-With a disulfide as acceptor.probable
1.8.4.12Peptide-methionine (R)-S-oxide reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K8D, chain A
Confidence level:very confident
Coverage over the Query: 121-249
View the alignment between query and template
View the model in PyMOL
Template: 3E0M, chain A
Confidence level:very confident
Coverage over the Query: 47-249
View the alignment between query and template
View the model in PyMOL