Citrus Sinensis ID: 025377

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTGTTKKQAKEKSSVSNHSSSKSKSNSKRGSETQAKFSKAVQSKDEEDEGLEEEDEEEHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccccccccccccccccccccHHHEEEEccHHHHHHHHHHccccccccHHHHHHHHHccccccEEHHccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccEEEEcccccccccccEEEccccccccccccccccHHHHcccccEEccccccccccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccEEEEccccccEEEcccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccEEEEcccHHcccccccccccHHHHHHHHcccccccccccccc
mdggggynprtveeVFGDFKGRRAGMIKALTTEVEEFyhqcdpekenlclygfpseqwevnlpaeevppelpepalginfardgmqekdWLSLVAVHSDAWLLSVAFYFGarfgfdksDRKRLFNMINELPTIFEVVTGttkkqakekssvsnhsssksksnskrgsetQAKFSKAvqskdeedegleeedeeehgetlcgacgenyaadeFWICCdvcekwfhgkcvkitparaehikqykcpscsnkrarp
mdggggynprtveevfgdfkgRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTifevvtgttkkqakekssvsnhsssksksnskrgsetqakfskavqskdeedegleeedeeehGETLCGACGENYAADEFWICCDVCEKWFHGKCVKItparaehikqykcpscsnkrarp
MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWevnlpaeevppelpepalGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTGTTKKQAkekssvsnhsssksksnskRGSETQAKFSKAVQSKdeedegleeedeeehgeTLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP
***********VEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLP***********ALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTG***********************************************************LCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKC**********
************EEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFD********************************************************************************ETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSN*****
MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTG**********************************************************TLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKC**********
********PRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTGT*******************************************************GETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTGTTKKQAKEKSSVSNHSSSKSKSNSKRGSETQAKFSKAVQSKDEEDEGLEEEDEEEHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query253 2.2.26 [Sep-21-2011]
Q5XEM9260 PHD finger protein ALFIN- yes no 0.992 0.965 0.740 4e-99
Q9M2B4250 PHD finger protein ALFIN- no no 0.980 0.992 0.750 6e-96
Q7XUW3256 PHD finger protein ALFIN- yes no 0.976 0.964 0.65 2e-91
A2XTW9256 PHD finger protein ALFIN- N/A no 0.976 0.964 0.646 2e-90
Q2R837254 PHD finger protein ALFIN- no no 0.988 0.984 0.717 4e-89
B8BJV8254 PHD finger protein ALFIN- N/A no 0.988 0.984 0.717 4e-89
Q40359257 PHD finger protein Alfin1 N/A no 0.964 0.949 0.719 2e-88
Q8S8M9256 PHD finger protein ALFIN- no no 0.996 0.984 0.692 3e-88
Q60DW3258 PHD finger protein ALFIN- no no 0.996 0.976 0.684 5e-88
A2Y4R8258 PHD finger protein ALFIN- N/A no 0.996 0.976 0.684 5e-88
>sp|Q5XEM9|ALFL5_ARATH PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana GN=AL5 PE=2 SV=1 Back     alignment and function desciption
 Score =  360 bits (925), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 194/262 (74%), Positives = 230/262 (87%), Gaps = 11/262 (4%)

Query: 1   MDGGGG-YNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWE 59
           M+GG   Y+PRTVEEVF DFKGRRAG+I+ALTT+VE+F+ QCDPEK+NLCLYGFP+E WE
Sbjct: 1   MEGGTAHYSPRTVEEVFRDFKGRRAGIIQALTTDVEDFFQQCDPEKQNLCLYGFPNEVWE 60

Query: 60  VNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSD 119
           VNLPAEEVPPELPEPALGINFARDGMQE++WLSLVAVHSDAWLLSV+FYFG+RFGFD++D
Sbjct: 61  VNLPAEEVPPELPEPALGINFARDGMQERNWLSLVAVHSDAWLLSVSFYFGSRFGFDRAD 120

Query: 120 RKRLFNMINELPTIFEVVTGTTKKQAKEKSSVSNHSSSKSKSNSK-RGSETQAKFSKAVQ 178
           RKRLF+MINE+PT++EVVTG  +KQ KE  S +N + ++SKSNSK RG E+++  SK + 
Sbjct: 121 RKRLFSMINEVPTVYEVVTGNAEKQTKEMPSSANQNGNRSKSNSKMRGLESKS--SKTIH 178

Query: 179 SK-------DEEDEGLEEEDEEEHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKIT 231
           +K        EE E  E+EDE+EHGETLCGACG+NYA+DEFWICCD+CEKWFHG+CVKIT
Sbjct: 179 AKDEEEGLELEEGEEEEDEDEDEHGETLCGACGDNYASDEFWICCDMCEKWFHGECVKIT 238

Query: 232 PARAEHIKQYKCPSCSNKRARP 253
           PARAEHIK YKCP+CSNKRARP
Sbjct: 239 PARAEHIKHYKCPTCSNKRARP 260
Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M2B4|ALFL3_ARATH PHD finger protein ALFIN-LIKE 3 OS=Arabidopsis thaliana GN=AL3 PE=2 SV=1 Back     alignment and function description
>sp|Q7XUW3|ALFL4_ORYSJ PHD finger protein ALFIN-LIKE 4 OS=Oryza sativa subsp. japonica GN=Os04g0444900 PE=2 SV=2 Back     alignment and function description
>sp|A2XTW9|ALFL4_ORYSI PHD finger protein ALFIN-LIKE 4 OS=Oryza sativa subsp. indica GN=OsI_16049 PE=3 SV=1 Back     alignment and function description
>sp|Q2R837|ALFL8_ORYSJ PHD finger protein ALFIN-LIKE 8 OS=Oryza sativa subsp. japonica GN=Os11g0244800 PE=2 SV=1 Back     alignment and function description
>sp|B8BJV8|ALFL8_ORYSI PHD finger protein ALFIN-LIKE 8 OS=Oryza sativa subsp. indica GN=OsI_35671 PE=3 SV=1 Back     alignment and function description
>sp|Q40359|ALFIN_MEDSA PHD finger protein Alfin1 OS=Medicago sativa GN=ALFIN-1 PE=1 SV=1 Back     alignment and function description
>sp|Q8S8M9|ALFL6_ARATH PHD finger protein ALFIN-LIKE 6 OS=Arabidopsis thaliana GN=AL6 PE=2 SV=1 Back     alignment and function description
>sp|Q60DW3|ALFL5_ORYSJ PHD finger protein ALFIN-LIKE 5 OS=Oryza sativa subsp. japonica GN=Os05g0419100 PE=2 SV=1 Back     alignment and function description
>sp|A2Y4R8|ALFL5_ORYSI PHD finger protein ALFIN-LIKE 5 OS=Oryza sativa subsp. indica GN=OsI_19996 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
343887303253 PHD finger protein [Citrus unshiu] 1.0 1.0 0.992 1e-146
224142915253 predicted protein [Populus trichocarpa] 1.0 1.0 0.909 1e-120
255550121251 DNA binding protein, putative [Ricinus c 0.992 1.0 0.905 1e-119
224088776253 predicted protein [Populus trichocarpa] 1.0 1.0 0.905 1e-117
302398547258 ALF domain class transcription factor [M 0.996 0.976 0.879 1e-113
359484453252 PREDICTED: PHD finger protein ALFIN-LIKE 0.992 0.996 0.889 1e-111
351725633254 PHD4 [Glycine max] gi|115394654|gb|ABI97 0.976 0.972 0.881 1e-110
225429632253 PREDICTED: PHD finger protein ALFIN-LIKE 0.996 0.996 0.912 1e-108
116790051254 unknown [Picea sitchensis] 0.996 0.992 0.792 1e-107
363806764252 uncharacterized protein LOC100794662 [Gl 0.972 0.976 0.854 1e-106
>gi|343887303|dbj|BAK61849.1| PHD finger protein [Citrus unshiu] Back     alignment and taxonomy information
 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 251/253 (99%), Positives = 252/253 (99%)

Query: 1   MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEV 60
           MD GGGYNPRTVEEVFGDFKGRRAGM+KALTTEVEEFYHQCDPEKENLCLYGFPSEQWEV
Sbjct: 1   MDAGGGYNPRTVEEVFGDFKGRRAGMVKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEV 60

Query: 61  NLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDR 120
           NLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDR
Sbjct: 61  NLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDR 120

Query: 121 KRLFNMINELPTIFEVVTGTTKKQAKEKSSVSNHSSSKSKSNSKRGSETQAKFSKAVQSK 180
           KRLFNMINELPTIFEVVTGTTKKQAKEKSSVSNHSSSKSKSNSKRGSETQAKFSKAVQSK
Sbjct: 121 KRLFNMINELPTIFEVVTGTTKKQAKEKSSVSNHSSSKSKSNSKRGSETQAKFSKAVQSK 180

Query: 181 DEEDEGLEEEDEEEHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQ 240
           DEEDEGLEEEDEEEHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQ
Sbjct: 181 DEEDEGLEEEDEEEHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQ 240

Query: 241 YKCPSCSNKRARP 253
           YKCPSCSNKRARP
Sbjct: 241 YKCPSCSNKRARP 253

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224142915|ref|XP_002324777.1| predicted protein [Populus trichocarpa] gi|222866211|gb|EEF03342.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255550121|ref|XP_002516111.1| DNA binding protein, putative [Ricinus communis] gi|223544597|gb|EEF46113.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224088776|ref|XP_002308535.1| predicted protein [Populus trichocarpa] gi|222854511|gb|EEE92058.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302398547|gb|ADL36568.1| ALF domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|359484453|ref|XP_003633111.1| PREDICTED: PHD finger protein ALFIN-LIKE 5-like [Vitis vinifera] gi|297738599|emb|CBI27844.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351725633|ref|NP_001237867.1| PHD4 [Glycine max] gi|115394654|gb|ABI97243.1| PHD4 [Glycine max] Back     alignment and taxonomy information
>gi|225429632|ref|XP_002280895.1| PREDICTED: PHD finger protein ALFIN-LIKE 5 [Vitis vinifera] gi|296081695|emb|CBI20700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|116790051|gb|ABK25484.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|363806764|ref|NP_001242022.1| uncharacterized protein LOC100794662 [Glycine max] gi|255642423|gb|ACU21475.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
TAIR|locus:2179709255 AL4 "AT5G26210" [Arabidopsis t 0.996 0.988 0.653 4.1e-88
TAIR|locus:2149867260 AL5 "AT5G20510" [Arabidopsis t 0.992 0.965 0.595 3.2e-81
TAIR|locus:2099321250 AL3 "AT3G42790" [Arabidopsis t 0.980 0.992 0.608 2.6e-79
TAIR|locus:2012577252 AL7 "AT1G14510" [Arabidopsis t 0.948 0.952 0.595 7.1e-77
TAIR|locus:2056281256 AL6 "AT2G02470" [Arabidopsis t 0.964 0.953 0.590 9e-77
UNIPROTKB|Q40359257 ALFIN-1 "PHD finger protein Al 0.964 0.949 0.597 1.5e-76
TAIR|locus:2169707241 AL1 "AT5G05610" [Arabidopsis t 0.513 0.539 0.606 6.8e-67
TAIR|locus:2074663246 AL2 "AT3G11200" [Arabidopsis t 0.936 0.963 0.522 5.8e-66
FB|FBgn0000541 2669 E(bx) "Enhancer of bithorax" [ 0.189 0.017 0.479 3.3e-09
UNIPROTKB|B0QZE1148 PHF8 "Histone lysine demethyla 0.173 0.297 0.431 4.6e-07
TAIR|locus:2179709 AL4 "AT5G26210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 880 (314.8 bits), Expect = 4.1e-88, P = 4.1e-88
 Identities = 166/254 (65%), Positives = 181/254 (71%)

Query:     1 MDGGGGYNPRTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWXX 60
             M+ GG YNPRTVEEVF DFKGRRAGMIKALTT+V+EF+  CDPEKENLCLYG P+E W  
Sbjct:     1 MEAGGAYNPRTVEEVFRDFKGRRAGMIKALTTDVQEFFRLCDPEKENLCLYGHPNEHWEV 60

Query:    61 XXXXXXXXXXXXXXXXGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDR 120
                             GINFARDGM EKDWLSLVAVHSDAWLL+VAF+FGARFGFDK+DR
Sbjct:    61 NLPAEEVPPELPEPVLGINFARDGMAEKDWLSLVAVHSDAWLLAVAFFFGARFGFDKADR 120

Query:   121 KRLFNMINELPTIFEVVTGTTKKQAXXXXXXXXXXXXXXXXXXXRGSETQAKFSKAV--Q 178
             KRLFNM+N+LPTIFEVV GT KKQ                    RGSE++AKFSK     
Sbjct:   121 KRLFNMVNDLPTIFEVVAGTAKKQGKDKSSVSNNSSNRSKSSSKRGSESRAKFSKPEPKD 180

Query:   179 SKXXXXXXXXXXXXXXXXXTLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHI 238
              +                 T CGACGE+YAADEFWICCD+CE WFHGKCVKITPARAEHI
Sbjct:   181 DEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHI 240

Query:   239 KQYKCPSCSNKRAR 252
             KQYKCPSCSNKRAR
Sbjct:   241 KQYKCPSCSNKRAR 254
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0035064 "methylated histone residue binding" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2149867 AL5 "AT5G20510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099321 AL3 "AT3G42790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012577 AL7 "AT1G14510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056281 AL6 "AT2G02470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40359 ALFIN-1 "PHD finger protein Alfin1" [Medicago sativa (taxid:3879)] Back     alignment and assigned GO terms
TAIR|locus:2169707 AL1 "AT5G05610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074663 AL2 "AT3G11200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0000541 E(bx) "Enhancer of bithorax" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZE1 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2R837ALFL8_ORYSJNo assigned EC number0.71760.98810.9842nono
Q8LA16ALFL7_ARATHNo assigned EC number0.7040.98020.9841nono
Q9M2B4ALFL3_ARATHNo assigned EC number0.75090.98020.992nono
Q40359ALFIN_MEDSANo assigned EC number0.71950.96440.9494N/Ano
B8B8I3ALFL2_ORYSINo assigned EC number0.61150.90900.9426N/Ano
B8AMA8ALFL3_ORYSINo assigned EC number0.59180.91690.9392N/Ano
A2XTW9ALFL4_ORYSINo assigned EC number0.64610.97620.9648N/Ano
B8B8C5ALFL9_ORYSINo assigned EC number0.68240.96830.8844N/Ano
Q5XEM9ALFL5_ARATHNo assigned EC number0.74040.99200.9653yesno
A2WXR5ALFL6_ORYSINo assigned EC number0.70960.96830.9007N/Ano
A2Y4R8ALFL5_ORYSINo assigned EC number0.68480.99600.9767N/Ano
O81488ALFL4_ARATHNo assigned EC number0.82280.99600.9882nono
A2Y0Q2ALFL1_ORYSINo assigned EC number0.60240.92880.9108N/Ano
Q7F2Z1ALFL6_ORYSJNo assigned EC number0.71370.96830.9007nono
B8BJV8ALFL8_ORYSINo assigned EC number0.71760.98810.9842N/Ano
Q7XUW3ALFL4_ORYSJNo assigned EC number0.650.97620.9648yesno
B8ADZ3ALFL7_ORYSINo assigned EC number0.69510.96040.9101N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0007007902
hypothetical protein (253 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
pfam12165137 pfam12165, DUF3594, Domain of unknown function (DU 1e-100
pfam0062851 pfam00628, PHD, PHD-finger 1e-10
smart0024947 smart00249, PHD, PHD zinc finger 7e-10
>gnl|CDD|221449 pfam12165, DUF3594, Domain of unknown function (DUF3594) Back     alignment and domain information 
 Score =  286 bits (734), Expect = e-100
 Identities = 116/137 (84%), Positives = 130/137 (94%)

Query: 10  RTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPP 69
           RTVEE+F DFK RRAG++KALTT+VE+FY QCDPEKENLCLYG P+E WEVNLPAEEVPP
Sbjct: 1   RTVEEIFKDFKARRAGIVKALTTDVEDFYQQCDPEKENLCLYGLPNESWEVNLPAEEVPP 60

Query: 70  ELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINE 129
           ELPEPALGINFARDGMQEKDWLSLVAVHSD+WLLSVAFYFGARFGF+++DRKRLF+MIN+
Sbjct: 61  ELPEPALGINFARDGMQEKDWLSLVAVHSDSWLLSVAFYFGARFGFNRNDRKRLFSMIND 120

Query: 130 LPTIFEVVTGTTKKQAK 146
           LPT+FEVVTG  KKQ+K
Sbjct: 121 LPTVFEVVTGAAKKQSK 137

This presumed domain is functionally uncharacterized.This domain family is found in eukaryotes, and is approximately 140 amino acids in length. The family is found in association with pfam00628. Length = 137
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 253
PF12165137 DUF3594: Domain of unknown function (DUF3594); Int 100.0
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 100.0
KOG1973274 consensus Chromatin remodeling protein, contains P 99.09
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 99.0
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.9
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.89
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.77
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 97.37
KOG1844 508 consensus PHD Zn-finger proteins [General function 97.34
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.87
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.52
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.44
KOG1512381 consensus PHD Zn-finger protein [General function 96.07
KOG0383 696 consensus Predicted helicase [General function pre 95.71
KOG2752 345 consensus Uncharacterized conserved protein, conta 95.69
KOG0957 707 consensus PHD finger protein [General function pre 95.43
KOG0954 893 consensus PHD finger protein [General function pre 95.35
KOG4299 613 consensus PHD Zn-finger protein [General function 95.14
KOG0957 707 consensus PHD finger protein [General function pre 94.26
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 94.24
KOG1244336 consensus Predicted transcription factor Requiem/N 94.14
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 93.71
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 93.69
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 92.98
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 91.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 89.6
KOG0956 900 consensus PHD finger protein AF10 [General functio 88.82
COG5141 669 PHD zinc finger-containing protein [General functi 87.95
KOG1512381 consensus PHD Zn-finger protein [General function 87.65
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 85.82
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 84.5
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 83.31
PF13901202 DUF4206: Domain of unknown function (DUF4206) 81.47
>PF12165 DUF3594: Domain of unknown function (DUF3594); InterPro: IPR021998 This presumed domain is functionally uncharacterised Back     alignment and domain information 
Probab=100.00  E-value=8.6e-94  Score=587.80  Aligned_cols=137  Identities=84%  Similarity=1.432  Sum_probs=135.2

Q ss_pred             CCHHHHHhhhhhhhhHHHHHhhHHHHHHHhhcCCCCcceeeecCCCCceeeeCCCCCCCCCCCCCccCccccCCCccccc
Q 025377           10 RTVEEVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMQEKD   89 (253)
Q Consensus        10 ~~~~~~f~d~~~rr~~~~~alt~d~~~f~~~c~p~~~~l~lyg~~~~~w~v~~p~~~~p~~~pep~~gin~~rd~~~~~~   89 (253)
                      ||||+||+||++||+|||||||+||++||+||||+||||||||+|||+|||+||+||||||||||+||||||||||+|+|
T Consensus         1 rtve~if~df~~RR~g~v~ALT~dve~Fy~~CDP~kenLCLYG~p~~~WeV~lP~eevPpeLPEPaLGINfaRDgM~r~d   80 (137)
T PF12165_consen    1 RTVEEIFRDFSGRRAGIVRALTTDVEEFYQQCDPEKENLCLYGHPDGTWEVNLPAEEVPPELPEPALGINFARDGMQRKD   80 (137)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCccccceEEecCCCCCeEEeCChHhCCCCCCCcccCcccccCCccHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhhhhhhHHHHHhhhhccccccChhhhHHHHHhhhcCCceeeeeccccccccc
Q 025377           90 WLSLVAVHSDAWLLSVAFYFGARFGFDKSDRKRLFNMINELPTIFEVVTGTTKKQAK  146 (253)
Q Consensus        90 wl~~va~h~d~wl~~~~~~~~~~~~f~~~~r~~lf~min~LPTv~EvVtg~~kkq~k  146 (253)
                      |||||||||||||||||||||||||||+++|+|||+|||+||||||||+|+++||.|
T Consensus        81 WLslVAvHsDsWLlsvAfy~gar~~~~~~~R~rLF~mIN~lpTv~Evv~g~~~~q~k  137 (137)
T PF12165_consen   81 WLSLVAVHSDSWLLSVAFYFGARFGFDKNERKRLFSMINDLPTVFEVVTGRAKKQSK  137 (137)
T ss_pred             HHHHHHHhccHHHHHHHHHHHHhhccChHHHHHHHHHHhcCchHHHHHhccccccCC
Confidence            999999999999999999999999999999999999999999999999999988854

This domain family is found in eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF00628 from PFAM.
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1844 consensus PHD Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
1we9_A64 Solution Structure Of Phd Domain In Nucleic Acid Bi 1e-23
3qzv_A 174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 5e-07
2f6j_A 174 Crystal Structure Of Phd Finger-Linker-Bromodomain 6e-07
3kv5_D 488 Structure Of Kiaa1718, Human Jumonji Demethylase, I 1e-06
2fui_A62 Nmr Solution Structure Of Phd Finger Fragment Of Hu 3e-06
2ri7_A 174 Crystal Structure Of Phd Finger-Linker-Bromodomain 3e-06
3kv4_A 447 Structure Of Phf8 In Complex With Histone H3 Length 4e-06
1wem_A76 Solution Structure Of Phd Domain In Death Inducer- 4e-06
1wep_A79 Solution Structure Of Phd Domain In Phf8 Length = 7 1e-05
3kqi_A75 Crystal Structure Of Phf2 Phd Domain Complexed With 2e-04
>pdb|1WE9|A Chain A, Solution Structure Of Phd Domain In Nucleic Acid Binding Protein-like Np_197993 Length = 64 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%)
Query: 200 CGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNK 249
           CGACGE+YAADEFWICCD+CE WFHGKCVKITPARAEHIKQYKCPSCSNK
Sbjct: 9   CGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNK 58
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 Back     alignment and structure
>pdb|2FUI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Human Bptf In Free State Length = 62 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 Back     alignment and structure
>pdb|1WEM|A Chain A, Solution Structure Of Phd Domain In Death Inducer- Obliterator 1(Dio-1) Length = 76 Back     alignment and structure
>pdb|1WEP|A Chain A, Solution Structure Of Phd Domain In Phf8 Length = 79 Back     alignment and structure
>pdb|3KQI|A Chain A, Crystal Structure Of Phf2 Phd Domain Complexed With H3k4me3 Peptide Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
1we9_A64 PHD finger family protein; structural genomics, PH 1e-24
3kv5_D 488 JMJC domain-containing histone demethylation prote 1e-17
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 2e-17
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-17
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 5e-17
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 6e-17
1wem_A76 Death associated transcription factor 1; structura 6e-17
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 1e-14
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 2e-14
1wee_A72 PHD finger family protein; structural genomics, PH 5e-14
3o70_A68 PHD finger protein 13; PHF13, structural genomics 9e-13
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 1e-11
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 2e-11
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 1e-10
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-09
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 4e-08
1wew_A78 DNA-binding family protein; structural genomics, P 4e-08
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 5e-07
1weu_A91 Inhibitor of growth family, member 4; structural g 6e-07
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 3e-06
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 9e-06
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 2e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-04
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 5e-04
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 6e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 8e-04
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
 Score = 92.2 bits (229), Expect = 1e-24
 Identities = 47/56 (83%), Positives = 49/56 (87%)

Query: 194 EHGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNK 249
                 CGACGE+YAADEFWICCD+CE WFHGKCVKITPARAEHIKQYKCPSCSNK
Sbjct: 3   SGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNK 58
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
1we9_A64 PHD finger family protein; structural genomics, PH 99.7
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.56
1wew_A78 DNA-binding family protein; structural genomics, P 99.53
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.53
1wee_A72 PHD finger family protein; structural genomics, PH 99.53
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.52
1wem_A76 Death associated transcription factor 1; structura 99.49
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.49
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.44
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.43
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.41
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.41
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.39
1weu_A91 Inhibitor of growth family, member 4; structural g 99.37
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.37
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.3
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.28
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.26
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.26
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.25
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.25
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.23
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.13
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.09
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.97
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 98.86
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.74
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.71
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.7
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.67
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.65
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.62
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.6
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.58
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.52
2yt5_A66 Metal-response element-binding transcription facto 98.5
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.47
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.41
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.24
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.22
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.22
3rsn_A 177 SET1/ASH2 histone methyltransferase complex subun; 98.2
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.11
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.08
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.07
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.95
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.9
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.88
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.83
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.61
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.21
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 96.87
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 96.84
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 96.46
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 93.48
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 93.05
2ect_A78 Ring finger protein 126; metal binding protein, st 91.63
2ecm_A55 Ring finger and CHY zinc finger domain- containing 91.27
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 90.52
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.17
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 89.28
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 88.71
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 88.01
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 87.68
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 86.57
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 86.57
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 85.34
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 82.84
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 81.31
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 80.46
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
Probab=99.70  E-value=3.1e-18  Score=123.41  Aligned_cols=59  Identities=80%  Similarity=1.578  Sum_probs=52.8

Q ss_pred             cCcceecccCCcccCCCceEEccCCCCeeeccccccCccccCCCCeEEcCCCCCcCCCC
Q 025377          195 HGETLCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP  253 (253)
Q Consensus       195 ~~~t~C~iC~~py~~d~~mIqCD~Ce~WfH~~CVgit~~~a~~id~y~Cp~C~~Kr~R~  253 (253)
                      .+..+|++|+++|+++++|||||.|+.|||+.|||++...++.++.|+|+.|..|++|+
T Consensus         4 ~e~~~C~~C~~~~~~~~~mI~Cd~C~~WfH~~Cvgl~~~~~~~~~~~~C~~C~~k~~~~   62 (64)
T 1we9_A            4 GSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPS   62 (64)
T ss_dssp             SSCCCCSSSCCCCCSSSCEEECSSSCCEEETTTTTCCTTGGGGCSSCCCHHHHTTTCSS
T ss_pred             CCCCCCCCCCCccCCCCCEEEccCCCCCCCccccCcChhHhcCCCcEECCCCcCcCCCC
Confidence            45578989999998789999999999999999999998877667899999999999884
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 253
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 9e-17
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 1e-13
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-10
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 1e-10
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-08
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 3e-07
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 5e-07
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 3e-05
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 1e-04
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 5e-04
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein At5g26210
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 70.4 bits (172), Expect = 9e-17
 Identities = 47/51 (92%), Positives = 49/51 (96%)

Query: 200 CGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKR 250
           CGACGE+YAADEFWICCD+CE WFHGKCVKITPARAEHIKQYKCPSCSNK 
Sbjct: 9   CGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKS 59
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.48
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 99.42
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.31
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.18
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.17
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.09
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.02
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.99
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.92
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.86
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.57
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.46
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 94.38
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 89.2
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 85.67
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 84.0
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 8
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.48  E-value=5.1e-15  Score=109.42  Aligned_cols=52  Identities=37%  Similarity=0.917  Sum_probs=46.1

Q ss_pred             eecccCCcccCCCceEEccCCCCeeeccccccCccccCCCCeEEcCCCCCcC
Q 025377          199 LCGACGENYAADEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKR  250 (253)
Q Consensus       199 ~C~iC~~py~~d~~mIqCD~Ce~WfH~~CVgit~~~a~~id~y~Cp~C~~Kr  250 (253)
                      +||+|+++++.+++||+||.|+.|||..|++++...+...+.|+|+.|..+.
T Consensus        13 v~CiC~~~~~~~~~mI~Cd~C~~W~H~~C~g~~~~~~~~~~~~~C~~C~~~~   64 (79)
T d1wepa_          13 VYCLCRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEAVF   64 (79)
T ss_dssp             CCSTTSCSCCSSSCEEEBTTTCCEEEHHHHTCCHHHHTTCSBBCCTTTTTTS
T ss_pred             eEeECCCccCCCCcEEECCCCCCcEeccccCcchhcCCCCCEEECccCcCCc
Confidence            3449999998888999999999999999999998887777889999998654
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure