Citrus Sinensis ID: 025388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MATAQLTASSIKVPARSLTSFDGLRPSSVKFASVGGAPSQRSFRRLVVKAAAVVAPKYTSIKPLGDRVLVKIKTVEEKTDGGIFLPSAAQTKPQAGEVVAVGEGKTVGKAKLDISVKVPGTQVIYSKYAGTELEFNGANHLILREDDVVGILETDEIKDLKPLNDRVFIKVAEAEETTAGGLLLTEASKEKPSIGMVIAVGPGPLDEEGNRKPLSIAPGNTVMYSKYAGNDFKGSDGTNYIALRASEVMAVLS
ccccccccccEEEccccccccccccccccccccccccccccccccEEEEEEEEcccccCEccccccEEEEEccccEECcccCEEEccccccccccCEEEEEcccCCccccEEEEEEEEcccEEEEEcccccEEEEccCEEEEEEcccEEEEEEccccccccccccEEEEEEEccccccccEEEEcccccccccCEEEEEEccccccccccEEEcccccccEEEEccccccCECcccccEEEEEEccEEEEEEc
*************PARSL***********************SFRRLVVKAAAVVAPKYTSIKPLGDRVLVKIKTVEEKTDGGIFLPSAAQTKPQAGEVVAVGEGKTVGKAKLDISVKVPGTQVIYSKYAGTELEFNGANHLILREDDVVGILETDEIKDLKPLNDRVFIKVAEAEETTAGGLLLTEASKEKPSIGMVIAVGPGPLDEEGNRKPLSIAPGNTVMYSKYAGNDFKGSDGTNYIALRASEVMAVLS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATAQLTASSIKVPARSLTSFDGLRPSSVKFASVGGAPSQRSFRRLVVKAAAVVAPKYTSIKPLGDRVLVKIKTVEEKTDGGIFLPSAAQTKPQAGEVVAVGEGKTVGKAKLDISVKVPGTQVIYSKYAGTELEFNGANHLILREDDVVGILETDEIKDLKPLNDRVFIKVAEAEETTAGGLLLTEASKEKPSIGMVIAVGPGPLDEEGNRKPLSIAPGNTVMYSKYAGNDFKGSDGTNYIALRASEVMAVLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
20 kDa chaperonin, chloroplastic Seems to function only as a co-chaperone, along with cpn60, and in certain cases is essential for the discharge of biologically active proteins from cpn60.confidentO65282
20 kDa chaperonin, chloroplastic Seems to function only as a co-chaperone, along with cpn60, and in certain cases is essential for the discharge of biologically active proteins from cpn60.probableQ02073

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WE3, chain O
Confidence level:very confident
Coverage over the Query: 158-253
View the alignment between query and template
View the model in PyMOL
Template: 1WE3, chain O
Confidence level:very confident
Coverage over the Query: 59-153
View the alignment between query and template
View the model in PyMOL