Citrus Sinensis ID: 025405


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MASTSASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
ccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccc
**************R****ATTLYNDNNTVIGEIRRALGMIKEIAVDLE*******VKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLL*******************LHKFREAVWNVHHAGEL********IVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTSASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 SUMO-protein ligase MMS21 E3 SUMO-protein ligase that modulates cell cycle progression and functions as a repressor of endocycle onset in meristems. May functions downstream of the meristem patterning transcription factors PLETHORA 1 and 2 (PLT1 and PLT2) in root meristem development. Modulates the expression of the mitotic cyclins CYCB1-1 and CYCB1-2 and cyclin-dependent kinases CDKB1-1 and CDKB2-1 in root meristem. Involved in cytokinin signaling in root development.probableQ8GYH7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HTK, chain C
Confidence level:confident
Coverage over the Query: 53-230
View the alignment between query and template
View the model in PyMOL
Template: 3OKQ, chain A
Confidence level:probable
Coverage over the Query: 16-107
View the alignment between query and template
View the model in PyMOL