Citrus Sinensis ID: 025405

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MASTSASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
ccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccc
cccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccHccEEEEccccccccEEccccccEEEEcccccccccccEEcccHHHHHHHHHcccccccccccHHHHHHHHHEHEHHHHHcHHHHHEEEEccccEEEEEcccccccccccc
mastsasrhdAVTGRIRNAAttlyndnntVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFgdcthhsaaiqsvgntyqpgteltdfKKLLVDedaksraasssvppndplhkfREAVWNVhhagelmpgeeqeDIVMTSTQSnilniscplsgkpitelaepvrryqilqiyprfsflpfcsldcyfprcnhfgcqlyfnwkKCVFKYHLKGHMLFMQVLEydgdiyllglasgtslcplye
mastsasrhdavtgrirnaattlyndnntviGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSraasssvppndplHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
MASTSASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
*************GRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLE*******VKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLL**********************FREAVWNVHHAGEL********IVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPL**
*******************ATTLYNDNNTVIGEIRRALGMIKEIAV****************ATIQLMEAFGDCTHHSAAI*******************L*******************LHKFREAV******************VMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQ*LEYDGDIYLLGLASGTSLCPLYE
************TGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDE************PNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
**************R*****TTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTSASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPLHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVLEYDGDIYLLGLASGTSLCPLYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query253 2.2.26 [Sep-21-2011]
Q8GYH7249 E3 SUMO-protein ligase MM yes no 0.893 0.907 0.5 1e-56
>sp|Q8GYH7|NSE2_ARATH E3 SUMO-protein ligase MMS21 OS=Arabidopsis thaliana GN=MMS21 PE=1 SV=1 Back     alignment and function desciption
 Score =  219 bits (559), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 151/228 (66%), Gaps = 2/228 (0%)

Query: 5   SASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDAT 64
           SAS  D V GRI+NA+  L +DN++ + +IR+A+ M+K IAV LEK+NQ+  VK+LE++ 
Sbjct: 3   SASSSDGVAGRIQNASLVLVSDNSSTLADIRKAVAMMKNIAVQLEKENQTDKVKDLENSV 62

Query: 65  IQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDPL-HK 123
            +L++   DC H S AIQSV N YQP  +LTDFKKLL DE  K +A  SSVP ND L  +
Sbjct: 63  AELLDLHSDCNHRSTAIQSVANRYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDHLMRQ 122

Query: 124 FREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIY 183
           FREAVWNVHHAGE MPG++ EDIVMTSTQ  +LN++CPLSGKP+TELA+PVR      +Y
Sbjct: 123 FREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDCRHVY 182

Query: 184 PRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQVL 231
            +   L +  ++     C   GC+      K +    LK  +  M+ L
Sbjct: 183 EKSVILHYI-VNNPNANCPVAGCRGKLQNSKVICDAMLKFEIEEMRSL 229
E3 SUMO-protein ligase that modulates cell cycle progression and functions as a repressor of endocycle onset in meristems. May functions downstream of the meristem patterning transcription factors PLETHORA 1 and 2 (PLT1 and PLT2) in root meristem development. Modulates the expression of the mitotic cyclins CYCB1-1 and CYCB1-2 and cyclin-dependent kinases CDKB1-1 and CDKB2-1 in root meristem. Involved in cytokinin signaling in root development.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
359493638261 PREDICTED: E3 SUMO-protein ligase MMS21- 0.853 0.827 0.570 9e-63
255564555253 conserved hypothetical protein [Ricinus 0.853 0.853 0.548 7e-60
449456611248 PREDICTED: E3 SUMO-protein ligase MMS21- 0.857 0.875 0.522 4e-59
224115350257 predicted protein [Populus trichocarpa] 0.849 0.836 0.529 2e-57
30683483249 E3 SUMO-protein ligase MMS21 [Arabidopsi 0.893 0.907 0.5 6e-55
11994504336 unnamed protein product [Arabidopsis tha 0.893 0.672 0.5 9e-55
297834382248 hypothetical protein ARALYDRAFT_897788 [ 0.889 0.907 0.495 2e-54
302142956 449 unnamed protein product [Vitis vinifera] 0.750 0.423 0.544 2e-50
343172924184 hypothetical protein, partial [Silene la 0.723 0.994 0.510 2e-47
343172926184 hypothetical protein, partial [Silene la 0.723 0.994 0.5 2e-47
>gi|359493638|ref|XP_002282690.2| PREDICTED: E3 SUMO-protein ligase MMS21-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  246 bits (627), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 158/219 (72%), Gaps = 3/219 (1%)

Query: 1   MASTSA--SRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVK 58
           MASTSA  SR + V GR+RNAA+TLY+DN ++I E R+A+ ++KE+AVDLE+D QSQMVK
Sbjct: 1   MASTSAAASRDNGVPGRLRNAASTLYSDNQSLIAEFRKAMILMKEVAVDLERDGQSQMVK 60

Query: 59  ELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPN 118
           ELEDA ++L+    DCT  SAAIQSVGN +QP  ELTDFKKL  DE AK +A+SS  P +
Sbjct: 61  ELEDAVVELLGTSEDCTQFSAAIQSVGNEHQPRPELTDFKKLFEDEVAKLKASSSFAPQS 120

Query: 119 DP-LHKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRY 177
            P L +FREAVWNVHHAG+ MPG+EQEDIVMTSTQ N+LNI+CPLSG+P+TELA+PVR  
Sbjct: 121 HPLLRQFREAVWNVHHAGQPMPGDEQEDIVMTSTQCNLLNITCPLSGRPVTELADPVRSV 180

Query: 178 QILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCV 216
               IY + + L +        +C    C      ++ V
Sbjct: 181 DCKHIYEKKAILHYIKSKHGRAQCPVAACPKILQAERVV 219

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255564555|ref|XP_002523273.1| conserved hypothetical protein [Ricinus communis] gi|223537486|gb|EEF39112.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449456611|ref|XP_004146042.1| PREDICTED: E3 SUMO-protein ligase MMS21-like [Cucumis sativus] gi|449510330|ref|XP_004163634.1| PREDICTED: E3 SUMO-protein ligase MMS21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224115350|ref|XP_002317010.1| predicted protein [Populus trichocarpa] gi|222860075|gb|EEE97622.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30683483|ref|NP_188133.2| E3 SUMO-protein ligase MMS21 [Arabidopsis thaliana] gi|75151435|sp|Q8GYH7.1|NSE2_ARATH RecName: Full=E3 SUMO-protein ligase MMS21; AltName: Full=MMS21 homolog; Short=AtMMS21; AltName: Full=Protein HIGH PLOIDY 2 gi|26450312|dbj|BAC42272.1| unknown protein [Arabidopsis thaliana] gi|111074302|gb|ABH04524.1| At3g15150 [Arabidopsis thaliana] gi|332642104|gb|AEE75625.1| E3 SUMO-protein ligase MMS21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|11994504|dbj|BAB02569.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834382|ref|XP_002885073.1| hypothetical protein ARALYDRAFT_897788 [Arabidopsis lyrata subsp. lyrata] gi|297330913|gb|EFH61332.1| hypothetical protein ARALYDRAFT_897788 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|302142956|emb|CBI20251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|343172924|gb|AEL99165.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|343172926|gb|AEL99166.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
TAIR|locus:2083641249 HPY2 "HIGH PLOIDY2" [Arabidops 0.747 0.759 0.562 8e-53
TAIR|locus:2083641 HPY2 "HIGH PLOIDY2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 547 (197.6 bits), Expect = 8.0e-53, P = 8.0e-53
 Identities = 108/192 (56%), Positives = 140/192 (72%)

Query:     1 MASTSASRHDAVTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKEL 60
             MAS S+S  D V GRI+NA+  L +DN++ + +IR+A+ M+K IAV LEK+NQ+  VK+L
Sbjct:     1 MASASSS--DGVAGRIQNASLVLVSDNSSTLADIRKAVAMMKNIAVQLEKENQTDKVKDL 58

Query:    61 EDATIQLMEAFGDCTHHSAAIQSVGNTYQPGTELTDFKKLLVDEDAKSRAASSSVPPNDP 120
             E++  +L++   DC H S AIQSV N YQP  +LTDFKKLL DE  K +A  SSVP ND 
Sbjct:    59 ENSVAELLDLHSDCNHRSTAIQSVANRYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDH 118

Query:   121 L-HKFREAVWNVHHAGELMPGEEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQI 179
             L  +FREAVWNVHHAGE MPG++ EDIVMTSTQ  +LN++CPLSGKP+TELA+PVR    
Sbjct:   119 LMRQFREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDC 178

Query:   180 LQIYPRFSFLPF 191
               +Y +   L +
Sbjct:   179 RHVYEKSVILHY 190


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.135   0.410    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      253       253   0.00083  114 3  11 22  0.43    33
                                                     32  0.47    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  607 (65 KB)
  Total size of DFA:  208 KB (2117 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  23.33u 0.16s 23.49t   Elapsed:  00:00:01
  Total cpu time:  23.33u 0.16s 23.49t   Elapsed:  00:00:01
  Start:  Fri May 10 07:55:11 2013   End:  Fri May 10 07:55:12 2013
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0019789 "SUMO ligase activity" evidence=IDA
GO:0032876 "negative regulation of DNA endoreduplication" evidence=IMP
GO:0048509 "regulation of meristem development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0008284 "positive regulation of cell proliferation" evidence=IMP
GO:0010082 "regulation of root meristem growth" evidence=IMP
GO:0016925 "protein sumoylation" evidence=IDA
GO:0045931 "positive regulation of mitotic cell cycle" evidence=IMP
GO:0080038 "positive regulation of cytokinin mediated signaling pathway" evidence=IMP
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0060250 "germ-line stem-cell niche homeostasis" evidence=IMP

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GYH7NSE2_ARATH6, ., 3, ., 2, ., -0.50.89320.9076yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 253
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 99.87
KOG2979262 consensus Protein involved in DNA repair [General 99.82
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 99.62
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.15
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.14
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 98.29
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.1
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.03
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.54
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.43
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.34
PF04641260 Rtf2: Rtf2 RING-finger 97.23
COG5222427 Uncharacterized conserved protein, contains RING Z 97.21
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.21
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.05
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.97
KOG2169 636 consensus Zn-finger transcription factor [Transcri 96.56
PF04641 260 Rtf2: Rtf2 RING-finger 96.43
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.17
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.16
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.05
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.99
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.96
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.85
KOG3039 303 consensus Uncharacterized conserved protein [Funct 95.68
KOG0289 506 consensus mRNA splicing factor [General function p 95.5
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.18
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 94.97
PHA02929238 N1R/p28-like protein; Provisional 94.97
KOG3113293 consensus Uncharacterized conserved protein [Funct 94.54
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 94.21
COG3364112 Zn-ribbon containing protein [General function pre 93.91
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.86
KOG0297 391 consensus TNF receptor-associated factor [Signal t 93.52
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.49
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 93.28
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 93.22
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 93.2
KOG2660 331 consensus Locus-specific chromosome binding protei 93.19
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 92.9
COG5109396 Uncharacterized conserved protein, contains RING Z 92.63
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.5
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 92.18
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 91.92
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 91.11
PF02146178 SIR2: Sir2 family; InterPro: IPR003000 These seque 90.89
PF1463444 zf-RING_5: zinc-RING finger domain 90.03
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 89.41
PRK14138244 NAD-dependent deacetylase; Provisional 89.05
PRK05333285 NAD-dependent deacetylase; Provisional 88.78
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 87.64
cd01410206 SIRT7 SIRT7: Eukaryotic and prokaryotic group (cla 87.33
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 86.89
PHA0062659 hypothetical protein 86.08
PLN03086567 PRLI-interacting factor K; Provisional 85.58
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 85.29
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 84.9
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 84.71
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 84.5
cd01413222 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group 83.55
COG5152259 Uncharacterized conserved protein, contains RING a 82.89
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 81.95
cd01407218 SIR2-fam SIR2 family of proteins includes silent i 81.85
KOG1002 791 consensus Nucleotide excision repair protein RAD16 81.0
cd01411225 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homo 80.47
KOG2979262 consensus Protein involved in DNA repair [General 80.23
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information 
Probab=99.87  E-value=2.8e-23  Score=148.54  Aligned_cols=57  Identities=23%  Similarity=0.577  Sum_probs=39.1

Q ss_pred             cceeeecccCccccccCCCCccccccccCCcccCCCCcccchhhHhhhhhcCCCCCCccccccc
Q 025405          144 EDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQ  207 (253)
Q Consensus       144 dDi~v~~~q~~~~n~~CPlT~~~i~~l~~Pv~s~~CgHvYek~aI~~~i~~~~~~~~CPv~GC~  207 (253)
                      |||+|++   +++|++||||+++   |++||+|++|||+|||++|++||+ +++..+||++||+
T Consensus         1 ddi~i~~---~~~~~~CPiT~~~---~~~PV~s~~C~H~fek~aI~~~i~-~~~~~~CPv~GC~   57 (57)
T PF11789_consen    1 DDIVIEG---GTISLKCPITLQP---FEDPVKSKKCGHTFEKEAILQYIQ-RNGSKRCPVAGCN   57 (57)
T ss_dssp             S-----S---SB--SB-TTTSSB----SSEEEESSS--EEEHHHHHHHCT-TTS-EE-SCCC-S
T ss_pred             CceEEec---cEeccCCCCcCCh---hhCCcCcCCCCCeecHHHHHHHHH-hcCCCCCCCCCCC
Confidence            6889886   4579999999976   599999999999999999999996 7789999999996

>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2169 consensus Zn-finger transcription factor [Transcription] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3364 Zn-ribbon containing protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02146 SIR2: Sir2 family; InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 56.8 bits (136), Expect = 2e-09
 Identities = 40/248 (16%), Positives = 72/248 (29%), Gaps = 70/248 (28%)

Query: 12  VTGRIRNAATTLYNDNNTVIGEIRRALGMIKEIAVDLEKDNQSQMVKELEDATIQL-MEA 70
           +T R +     L     T I     ++ +  +    L       ++K L+     L  E 
Sbjct: 270 LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSL-------LLKYLDCRPQDLPREV 322

Query: 71  FGDCTHHSAAIQSVGNTYQPGTELTD-FKKLLVDEDAKSRAASSSV---PPNDPLHKFR- 125
               T +   +  +  + + G    D +K   V+ D  +    SS+    P +    F  
Sbjct: 323 ---LTTNPRRLSIIAESIRDGLATWDNWKH--VNCDKLTTIIESSLNVLEPAEYRKMFDR 377

Query: 126 ---------------EAVWNVHHAGELMPGEEQEDIVMTSTQSNILN------------I 158
                            +W        +   +   +V    + +++             I
Sbjct: 378 LSVFPPSAHIPTILLSLIWFD------VIKSDVMVVVNKLHKYSLVEKQPKESTISIPSI 431

Query: 159 SCPLSGKPITELA---EPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKC 215
              L  K   E A     V  Y I + +     +P   LD YF   +H G          
Sbjct: 432 YLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPY-LDQYF--YSHIG---------- 478

Query: 216 VFKYHLKG 223
              +HLK 
Sbjct: 479 ---HHLKN 483

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.96
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.61
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.31
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 99.14
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.13
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.08
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.08
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.95
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 98.93
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.9
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.88
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.52
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.38
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.26
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.24
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.23
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.19
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.18
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.15
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.14
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.11
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.09
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.08
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.08
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.02
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.02
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.02
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.94
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.94
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.87
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.85
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.72
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.69
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.63
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.62
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.58
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.55
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.54
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.52
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.48
2ect_A78 Ring finger protein 126; metal binding protein, st 97.39
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 97.35
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.34
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.27
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.06
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 96.52
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 96.46
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.43
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.38
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.31
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.3
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.17
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.12
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 96.1
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.44
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 94.73
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 93.37
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 92.53
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 92.37
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 91.6
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 90.93
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 90.26
3okq_A141 BUD site selection protein 6; coiled-coil, protein 89.85
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 89.82
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 87.83
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 86.7
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 86.04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 84.75
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 84.33
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 84.0
1q14_A 361 HST2 protein; histone deacetylase, hydrolase; 2.50 83.98
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 83.84
1vd4_A62 Transcription initiation factor IIE, alpha subunit 83.48
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 82.92
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 82.71
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 82.55
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 81.94
1m2k_A249 Silent information regulator 2; protein-ligand com 80.45
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.96  E-value=7.3e-29  Score=223.66  Aligned_cols=171  Identities=10%  Similarity=0.202  Sum_probs=137.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHhHhHHHHHHHHHHHhhcCCC---CC---cchHHHHHHHHH---------Hhhh-hcCCCCC
Q 025405           53 QSQMVKELEDATIQLMEAFGDCTHHSAAIQSVGNTYQPG---TE---LTDFKKLLVDED---------AKSR-AASSSVP  116 (253)
Q Consensus        53 ~~~~vkeLe~~v~eL~~~~~e~~~~~~Alq~l~~~yq~~---~e---~~df~k~~~~e~---------~~~k-~~s~~~~  116 (253)
                      ..+.|++|.+.+++|+.++++.+.+..+++++++.|...   .+   ..++.++...++         .++. .++....
T Consensus        59 ~~~~v~~l~~~y~~l~~~~~~~~~~~~~~~~~K~~yk~~~d~~~~~~~~twd~y~~~e~~ap~l~~~~~~~~~~~~~~~~  138 (267)
T 3htk_C           59 IEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMV  138 (267)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCCTTHHHHHHHTSSCCCCHHHHHHTCCCCSCCSCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCHHHHHHHhcCCcCCchHHHHHHhccccCccccc
Confidence            578999999999999999999999999999998887642   12   234444444333         1222 2223345


Q ss_pred             CCCchh-hhHHHHhhhccCCCCCCC----CCCcceeeecccCccccccCCCCccccccccCCcccCCCCcccchhhHhhh
Q 025405          117 PNDPLH-KFREAVWNVHHAGELMPG----EEQEDIVMTSTQSNILNISCPLSGKPITELAEPVRRYQILQIYPRFSFLPF  191 (253)
Q Consensus       117 ~~~~~~-~Fke~I~~v~~~g~p~p~----deddDi~v~~~q~~~~n~~CPlT~~~i~~l~~Pv~s~~CgHvYek~aI~~~  191 (253)
                      .+++++ .||..+|.+++|+.|+|+    ++||||+|++.   ..+++||||+.   .|++||+++.|||+|+|.+|.+|
T Consensus       139 ~~~~~~~~lk~~~~i~~~P~~~lPd~~~~~dDDDI~v~~~---~~el~CPIcl~---~f~DPVts~~CGHsFcR~cI~~~  212 (267)
T 3htk_C          139 NNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGG---KIELTCPITCK---PYEAPLISRKCNHVFDRDGIQNY  212 (267)
T ss_dssp             CCCHHHHHHHHHHHHHHCTTBCCCCCSSTTCSSCCCCCSS---BCCSBCTTTSS---BCSSEEEESSSCCEEEHHHHHHH
T ss_pred             ccchHHHHHHHccccccCCCCCCCCCCCCCCCccceecCC---ceeeECcCccC---cccCCeeeCCCCCcccHHHHHHH
Confidence            678899 999999999999999986    57889998764   46999999995   57999999999999999999999


Q ss_pred             hhcCCCCCCccccccccccccCcccccHhHhhHhHHHHh
Q 025405          192 CSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLFMQV  230 (253)
Q Consensus       192 i~~~~~~~~CPv~GC~~~l~~~dL~~D~~l~~~~~~~~~  230 (253)
                      ++ .++...||++||++.++..+|++|..|++.+...+.
T Consensus       213 ~~-~~~~~~CPvtGCr~~l~~~dL~pN~~L~~lve~~k~  250 (267)
T 3htk_C          213 LQ-GYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKM  250 (267)
T ss_dssp             ST-TCSCEECSGGGCSCEECGGGEEECHHHHHHHHHHHH
T ss_pred             HH-hCCCCCCCcccccCcCchhhCCcCHHHHHHHHHHHH
Confidence            98 445689999999999999999999999887765443
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>3okq_A BUD site selection protein 6; coiled-coil, protein binding; 2.04A {Saccharomyces cerevisiae} PDB: 3onx_A Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.24
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.2
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.18
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.03
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.82
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.74
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.16
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.81
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.42
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.02
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.88
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 96.71
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.52
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 95.66
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 95.03
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 93.53
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 86.01
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 83.73
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Ubiquitin conjugation factor E4A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.24  E-value=2e-12  Score=98.38  Aligned_cols=63  Identities=10%  Similarity=-0.048  Sum_probs=54.5

Q ss_pred             cccCCCCccccccccCCcccCCCCcccchhhHhhhhhcCCCCCCccccccccccccCcccccHhHhhHhHH
Q 025405          157 NISCPLSGKPITELAEPVRRYQILQIYPRFSFLPFCSLDCYFPRCNHFGCQLYFNWKKCVFKYHLKGHMLF  227 (253)
Q Consensus       157 n~~CPlT~~~i~~l~~Pv~s~~CgHvYek~aI~~~i~~~~~~~~CPv~GC~~~l~~~dL~~D~~l~~~~~~  227 (253)
                      .|.||||+.   .|.+||....|||+|+|.+|..||. +  +..||+  |+..|+.++|+++..|++.+.-
T Consensus        22 ~f~CPI~~~---lm~dPV~~~~~~~ty~r~~I~~~l~-~--~~~~P~--~~~~l~~~~L~pN~~Lr~~I~~   84 (98)
T d1wgma_          22 EFLDPIMST---LMCDPVVLPSSRVTVDRSTIARHLL-S--DQTDPF--NRSPLTMDQIRPNTELKEKIQR   84 (98)
T ss_dssp             TTBCTTTCS---BCSSEEECTTTCCEEEHHHHHHHTT-T--SCBCTT--TCSBCCTTTSEECHHHHHHHHH
T ss_pred             HhCCcCchh---HHHHHHhcccccchhhHHHHHHHHH-h--cCCccc--ccccccchhhcchHHHHHHHHH
Confidence            799999994   5799999987888999999999997 2  346999  5667999999999999998864
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure