Citrus Sinensis ID: 025444

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--

MVEMLITRSSGSLRKLCVSGLHNDMMFSLIAENAGSLQTLRLPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGNFPNLKVLGPFVMDYYEINDWDDCSDYSDGSEYLAWEFLAGEMGDYDDDDEIYEGMWDDEGRLEELELRFYDGIEEDAGIYGWPPSP

cHHHHHHHccccccEEEccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHccccccEEECcccccccHHHHHHHHHHccccccEEcccccccccccccccHHHHHHHcccccccEEEcccccccHHHHHHHHHccccccEEEccccccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccEEEEccccccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box protein FBW2	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	probable	Q9ZPE4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 6-174
View the alignment between query and template
View the model in PyMOL