Citrus Sinensis ID: 025457


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MSLAVGVDSSSKNMGLDDKDKSNKSEVSGETMPKTPPNEENVDEQSGGMSRQMSENSISVTEDEEDDEDRKIELGPQYTLKEQFEKDKDDESLRRWKEQLLGSVDFESVGESLEPEVKILSLAIKTPSRPDIVLSVPENGRPKGSWFTLKEGSRYSLQFSFQVRNNIVSGLKYTNTVWKTGLKVDSTKMMLGTFSPQAEPYTQELPEDTTPSGFFARGSYSAKSKFVDDDNKCYLEINYTFDIGKEWLQTEV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHcccccccccccccccEEEEEEEEEEccccccEEECccccccccccEEEEccccEEEEEEEEEEccEEEcccEEEEEEEEccEEEccccccEEEcccccccEEEEccccccccCEEEEEEEEEEEEEECccccCEEEEEEEEEEEcccccccc
********************************************************************************KEQFEKDKDDESLRRWKEQLLGSVDF*SV*ESLEPEVKILSLAIKTPSRPDIVLSVPENGRPKGSWFTLKEGSRYSLQFSFQVRNNIVSGLKYTNTVWKTGLKVDSTKMMLGTFSPQAEPYTQELPEDTTPSGFFARGSYSAKSKFVDDDNKCYLEINYTFDIGKEWL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLAVGVDSSSKNMGLDDKDKSNKSEVSGETMPKTPPNEENVDEQSGGMSRQMSENSISVTEDEEDDEDRKIELGPQYTLKEQFEKDKDDESLRRWKEQLLGSVDFESVGESLEPEVKILSLAIKTPSRPDIVLSVPENGRPKGSWFTLKEGSRYSLQFSFQVRNNIVSGLKYTNTVWKTGLKVDSTKMMLGTFSPQAEPYTQELPEDTTPSGFFARGSYSAKSKFVDDDNKCYLEINYTFDIGKEWLQTEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho GDP-dissociation inhibitor 1 Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.probableQ9SFC6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DOA, chain B
Confidence level:very confident
Coverage over the Query: 61-249
View the alignment between query and template
View the model in PyMOL