Citrus Sinensis ID: 025462


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MIMQFSTALRSDFARPASADSKQISNGVSAHFRGQCNRGYIVNLRLPFQQMDSRVANSKTYCSARSFASKTSKQGTETSSEPKKDISTVEDPFDAPTYNIPEKPVTFTEGASYSLIILAGLGVAGAAAYAVFKELIFEPKEYKIFNKALKRIQDDGQVRVRIGSPITGYGQESRNRAARQRIPNRVYTDEFGIEHVEVNFYIRGPHGAGKVFTEMFKDKEDKQWKFTYLIVEITSPYKAQLMLESYMPAAPA
ccccccHHHccccccccccccccccccccccccccccccCEEEcccccccccccccccccccccccCEECccccccccccccccccccccccccccccccccccEEEEcccEEHHHHHHHHHHHHHHHHEEEEEEEcccccHHHHHHHHHHHHccHHHHHHHcccCEEECccccccccccccccEEEEcccccEEEEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEcccccccc
**************R*************SAHFRGQCNRGYIVNLRLPFQQM*********YC***********************************YNIPEKPVTFTEGASYSLIILAGLGVAGAAAYAVFKELIFEPKEYKIFNKALKRIQDDGQVRVRIGSPITGYG**********RIPNRVYTDEFGIEHVEVNFYIRGPHGAGKVFTEMFKDKEDKQWKFTYLIVEITSPYKAQLMLESY******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMQFSTALRSDFARPASADSKQISNGVSAHFRGQCNRGYIVNLRLPFQQMDSRVANSKTYCSARSFASKTSKQGTETSSEPKKDISTVEDPFDAPTYNIPEKPVTFTEGASYSLIILAGLGVAGAAAYAVFKELIFEPKEYKIFNKALKRIQDDGQVRVRIGSPITGYGQESRNRAARQRIPNRVYTDEFGIEHVEVNFYIRGPHGAGKVFTEMFKDKEDKQWKFTYLIVEITSPYKAQLMLESYMPAAPA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable mitochondrial import inner membrane translocase subunit TIM21 May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.probableQ1G3L1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CIU, chain A
Confidence level:very confident
Coverage over the Query: 139-246
View the alignment between query and template
View the model in PyMOL