Citrus Sinensis ID: 025464

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MPIYRIAIGTPGEASHPDALKAALAEFFSMIIFVFAGQGSGMAFSKLTDGGASTPAGLISASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLLRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAAIVYDHIFIDDNAHQPLPANDF
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccHHHHHHHHHHHHHHHHHHEEEEECcccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHHHcccccccccccccc
***YRIAIGTPGEASHPDALKAALAEFFSMIIFVFAGQGSGMAFSKLTDGGASTPAGLISASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLLRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAAIVYDHIFIDD***********
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIYRIAIGTPGEASHPDALKAALAEFFSMIIFVFAGQGSGMAFSKLTDGGASTPAGLISASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLLRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAAIVYDHIFIDDNAHQPLPANDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aquaporin TIP1-2 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. May be involved in transport from the vacuolar compartment to the cytoplasm.confidentQ94CS9
Aquaporin TIP1-3 Potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.confidentO82598
Aquaporin TIP1-1 Water channel required to facilitate the transport of water across cell membrane. May support the rapid influx of water into vacuoles during cell expansion, permit osmotic equilibration between the cytosol and the vacuolar content and rapid transcellular water flow through living cells. Its function is impaired by Hg(2+).probableO64964

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J4N, chain A
Confidence level:very confident
Coverage over the Query: 12-242
View the alignment between query and template
View the model in PyMOL