Citrus Sinensis ID: 025500

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MAEEKHQVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
ccccccccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHcccccccEEEEEEcccEEcccccccccccHHHHHHHHHHHHcccccccEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHccc
cccccccccEEEccccccEEEHcccccccccccccccccHHHHHHHHHHHHHccccEEcccHccccccHHHHHHHHHccccccEEEEEEEccEEccccccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHcccEEEccccccccccccccccccccccHHHHccccccHHHHHHHHHcc
maeekhqvprvklgtqglevsklgygcmnlsggysspvseedgISMIKHAFskgitffdtadvygQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYyqhrvdtsvpiEETIGEMKKLVEEGKIKyiglseaspgtirrahaVHPITAVQMEWSLWTRDIEEEIIPLCRelgigivpysplgrgffggkavvenvpadsFLVLFSvnvyphhfvssvsti
maeekhqvprvklgtqgleVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQhrvdtsvpieETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
MAEEKHQVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFgiagigvagvivkgaPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
***************QGLEVSKLGYGCMNLSGGYS******DGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFV******
************LGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
**********VKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
******QVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEKHQVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLVLFSVNVYPHHFVSSVSTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
C6TBN2346 Probable aldo-keto reduct yes no 0.900 0.656 0.806 1e-109
Q3L181337 Perakine reductase OS=Rau N/A no 0.900 0.673 0.754 1e-100
Q93ZN2345 Probable aldo-keto reduct yes no 0.888 0.649 0.681 2e-83
O22707345 Probable aldo-keto reduct no no 0.904 0.660 0.652 5e-83
F4HPY8330 Probable aldo-keto reduct no no 0.869 0.663 0.666 1e-82
Q84M96346 Probable aldo-keto reduct no no 0.908 0.661 0.643 5e-82
P40691307 Auxin-induced protein PCN N/A no 0.920 0.755 0.641 7e-82
Q9ASZ9345 Probable aldo-keto reduct no no 0.869 0.634 0.665 8e-80
A2XRZ0351 Probable aldo-keto reduct N/A no 0.884 0.635 0.651 3e-79
Q7XT99351 Probable aldo-keto reduct no no 0.888 0.638 0.646 4e-79
>sp|C6TBN2|AKR1_SOYBN Probable aldo-keto reductase 1 OS=Glycine max GN=AKR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  393 bits (1009), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/227 (80%), Positives = 207/227 (91%)

Query: 7   QVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQ 66
           Q+  VKLGTQG EVSKLG+GCM L+G Y+ P+ E+DGIS+IK+AFSKGITFFDTADVYG 
Sbjct: 5   QIQPVKLGTQGFEVSKLGFGCMGLTGAYNDPLQEQDGISVIKYAFSKGITFFDTADVYGA 64

Query: 67  NANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYI 126
           NANE+L+GKALKQLPREKIQ+ATKFGIA  G   + ++G+P+YVRSCCE  LKRLDV+YI
Sbjct: 65  NANELLVGKALKQLPREKIQIATKFGIASRGFPDMKIEGSPEYVRSCCETGLKRLDVEYI 124

Query: 127 DLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWS 186
           DLYYQHRVDTSVPIEET+GE+KKLVEEGK+KYIGLSEASP TIRRAHA+HPITAVQ+EWS
Sbjct: 125 DLYYQHRVDTSVPIEETVGELKKLVEEGKVKYIGLSEASPDTIRRAHAIHPITAVQIEWS 184

Query: 187 LWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFL 233
           LWTRDIEEEI+PLCRELGIGIVPYSPLGRGFFGGK VVENVP +S L
Sbjct: 185 LWTRDIEEEIVPLCRELGIGIVPYSPLGRGFFGGKGVVENVPTNSSL 231
May interfere with the nodulation process and inhibits nodule development.
Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q3L181|PERR_RAUSE Perakine reductase OS=Rauvolfia serpentina GN=PR PE=1 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|F4HPY8|AKR6_ARATH Probable aldo-keto reductase 6 OS=Arabidopsis thaliana GN=At1g60750 PE=3 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 Back     alignment and function description
>sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 Back     alignment and function description
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
378548275346 RecName: Full=Probable aldo-keto reducta 0.900 0.656 0.806 1e-107
225451318343 PREDICTED: auxin-induced protein PCNT115 0.900 0.661 0.824 1e-107
356571605345 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.904 0.660 0.802 1e-107
255542314343 aldo/keto reductase, putative [Ricinus c 0.928 0.682 0.769 1e-106
110289083249 Auxin-induced protein PCNT115, putative, 0.944 0.955 0.743 1e-105
225451312342 PREDICTED: auxin-induced protein PCNT115 0.908 0.669 0.808 1e-105
356505965351 PREDICTED: auxin-induced protein PCNT115 0.932 0.669 0.784 1e-105
359487894 362 PREDICTED: auxin-induced protein PCNT115 0.900 0.627 0.815 1e-105
298204875342 unnamed protein product [Vitis vinifera] 0.900 0.663 0.815 1e-105
356573095346 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.904 0.658 0.799 1e-105
>gi|378548275|sp|C6TBN2.1|AKR1_SOYBN RecName: Full=Probable aldo-keto reductase 1; Short=GmAKR1 gi|255637828|gb|ACU19234.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 183/227 (80%), Positives = 207/227 (91%)

Query: 7   QVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQ 66
           Q+  VKLGTQG EVSKLG+GCM L+G Y+ P+ E+DGIS+IK+AFSKGITFFDTADVYG 
Sbjct: 5   QIQPVKLGTQGFEVSKLGFGCMGLTGAYNDPLQEQDGISVIKYAFSKGITFFDTADVYGA 64

Query: 67  NANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYI 126
           NANE+L+GKALKQLPREKIQ+ATKFGIA  G   + ++G+P+YVRSCCE  LKRLDV+YI
Sbjct: 65  NANELLVGKALKQLPREKIQIATKFGIASRGFPDMKIEGSPEYVRSCCETGLKRLDVEYI 124

Query: 127 DLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWS 186
           DLYYQHRVDTSVPIEET+GE+KKLVEEGK+KYIGLSEASP TIRRAHA+HPITAVQ+EWS
Sbjct: 125 DLYYQHRVDTSVPIEETVGELKKLVEEGKVKYIGLSEASPDTIRRAHAIHPITAVQIEWS 184

Query: 187 LWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFL 233
           LWTRDIEEEI+PLCRELGIGIVPYSPLGRGFFGGK VVENVP +S L
Sbjct: 185 LWTRDIEEEIVPLCRELGIGIVPYSPLGRGFFGGKGVVENVPTNSSL 231

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225451318|ref|XP_002273776.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|298204867|emb|CBI34174.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356571605|ref|XP_003553967.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] Back     alignment and taxonomy information
>gi|255542314|ref|XP_002512220.1| aldo/keto reductase, putative [Ricinus communis] gi|223548181|gb|EEF49672.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|110289083|gb|ABG66079.1| Auxin-induced protein PCNT115, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225451312|ref|XP_002278643.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|298204874|emb|CBI34181.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505965|ref|XP_003521759.1| PREDICTED: auxin-induced protein PCNT115-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|359487894|ref|XP_002273300.2| PREDICTED: auxin-induced protein PCNT115-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204875|emb|CBI34182.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356573095|ref|XP_003554700.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
TAIR|locus:2036504345 ATB2 [Arabidopsis thaliana (ta 0.888 0.649 0.663 3.5e-75
TAIR|locus:2036551330 AT1G60750 [Arabidopsis thalian 0.869 0.663 0.652 2.5e-74
TAIR|locus:2036611345 AT1G60690 "AT1G60690" [Arabido 0.904 0.660 0.634 5.1e-74
TAIR|locus:2036591346 AT1G60680 "AT1G60680" [Arabido 0.908 0.661 0.630 8.4e-74
TAIR|locus:2196446344 AT1G10810 "AT1G10810" [Arabido 0.869 0.636 0.624 1.5e-67
TIGR_CMR|SPO_A0345327 SPO_A0345 "oxidoreductase, ald 0.829 0.639 0.535 1.3e-52
TIGR_CMR|GSU_3126334 GSU_3126 "oxidoreductase, aldo 0.825 0.622 0.506 2.4e-51
UNIPROTKB|G4NAH9341 MGG_09715 "Aldo-keto reductase 0.924 0.683 0.429 1.2e-44
POMBASE|SPAC1F7.12340 yak3 "aldose reductase ARK13 f 0.833 0.617 0.454 1.1e-41
ASPGD|ASPL0000072041351 AN8733 [Emericella nidulans (t 0.821 0.589 0.413 4.2e-40
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 758 (271.9 bits), Expect = 3.5e-75, P = 3.5e-75
 Identities = 150/226 (66%), Positives = 171/226 (75%)

Query:     8 VPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQN 67
             V R+KLG+QGLEVS  G GCM LS  Y +P  E + I++I HA   G+T  DT+D+YG  
Sbjct:     7 VRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPE 66

Query:    68 ANEVLLGKALKQLPREKIQVATKFXXXXXXXXXXXXXXXPDYVRSCCEASLKRLDVDYID 127
              NEVLLGKALK   REK+++ATKF               P+YVR+ CEASLKRLD+  ID
Sbjct:    67 TNEVLLGKALKDGVREKVELATKFGISYAEGKREVRGD-PEYVRAACEASLKRLDIACID 125

Query:   128 LYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSL 187
             LYYQHRVDT VPIE T+GE+KKLVEEGKIKYIGLSEAS  TIRRAHAVHPITAVQ+EWSL
Sbjct:   126 LYYQHRVDTRVPIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSL 185

Query:   188 WTRDIEEEIIPLCRELGIGIVPYSPLGRGFFG-GKAVVENVPADSF 232
             WTRD+EEEIIP CRELGIGIV YSPLGRGFF  G  +VEN+  D F
Sbjct:   186 WTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDF 231
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C6TBN2AKR1_SOYBN1, ., 1, ., 1, ., -0.80610.90070.6560yesno
Q3L181PERR_RAUSE1, ., 1, ., 1, ., 3, 1, 70.75430.90070.6735N/Ano
Q93ZN2ALKR4_ARATH1, ., 1, ., 1, ., -0.68140.88880.6492yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 2e-88
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 2e-84
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 2e-69
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 3e-38
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 7e-32
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 6e-30
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 9e-29
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 1e-22
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 1e-21
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 1e-21
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 2e-17
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 1e-10
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 2e-07
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  262 bits (673), Expect = 2e-88
 Identities = 97/229 (42%), Positives = 131/229 (57%), Gaps = 11/229 (4%)

Query: 10  RVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNAN 69
              LG  GL+VS+LG G   L GGY   V EE+  + ++ A   GI F DTADVYG   +
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLGGGY---VDEEEAAAAVRAALDAGINFIDTADVYGDGES 57

Query: 70  EVLLGKALKQLP-REKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDL 128
           E LLG+ALK+   RE++ +ATK G             +P+++R   E SLKRL  DYIDL
Sbjct: 58  EELLGEALKERGPREEVFIATKVGPRPGDGRD----LSPEHIRRAVEESLKRLGTDYIDL 113

Query: 129 YYQHRVDTSVP-IEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAV--HPITAVQMEW 185
           Y  H  D   P IEET+  +++LV+EGKI+ IG+S  S   +  A A    P    Q+E+
Sbjct: 114 YLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVEY 173

Query: 186 SLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLV 234
           +L  R  EEE++P CRE GIG++ YSPL  G   GK +    P +  L+
Sbjct: 174 NLLDRQAEEELLPYCREHGIGVIAYSPLAGGLLTGKYLPGAPPPEGDLL 222

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
PLN02587314 L-galactose dehydrogenase 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.13
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 96.13
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 93.91
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 93.63
PRK08392215 hypothetical protein; Provisional 92.43
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 91.81
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 91.81
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 91.5
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 91.39
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 90.85
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 90.44
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 90.15
cd00308229 enolase_like Enolase-superfamily, characterized by 89.52
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 89.39
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 88.49
cd03322361 rpsA The starvation sensing protein RpsA from E.co 88.46
TIGR01502408 B_methylAsp_ase methylaspartate ammonia-lyase. Thi 87.94
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 87.0
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 86.51
PRK07945335 hypothetical protein; Provisional 86.2
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 85.01
PRK08609570 hypothetical protein; Provisional 84.78
PRK13796 365 GTPase YqeH; Provisional 83.78
PRK05692 287 hydroxymethylglutaryl-CoA lyase; Provisional 83.19
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 83.18
PLN02428349 lipoic acid synthase 82.36
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 82.24
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 82.0
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 81.83
cd03314369 MAL Methylaspartate ammonia lyase (3-methylasparta 81.72
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 81.37
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 81.32
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 81.31
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 81.15
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 80.35
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 80.09
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1e-53  Score=373.66  Aligned_cols=216  Identities=46%  Similarity=0.742  Sum_probs=196.5

Q ss_pred             cCceecCCCCccccceeecccccCCCCCCCCCHHHHHHHHHHHHHCCCCEEeCcCCcCCCcHHHHHHHHHhcCC-CCCEE
Q 025500            8 VPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP-REKIQ   86 (252)
Q Consensus         8 m~~~~lg~~g~~vs~lglG~~~~g~~~~~~~~~~~~~~~l~~A~~~Gin~~Dta~~Yg~g~se~~ig~~l~~~~-R~~~~   86 (252)
                      |.+|+||++|++||+||||||.+|+.+.. .+++++.++|++|+++||||||||+.||.|.||+++|++|++.+ |++++
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~~~~-~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vv   79 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGDTDD-EEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVV   79 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCCCCc-hhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEE
Confidence            78999999999999999999999975332 25567888999999999999999999999999999999999744 89999


Q ss_pred             EEeccCccCCCCccc-ccCCChHHHHHHHHHHHHHcCCCcccEEEccCCCCCCCHHHHHHHHHHHHHcCCccEEEccCCC
Q 025500           87 VATKFGIAGIGVAGV-IVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEAS  165 (252)
Q Consensus        87 i~tK~~~~~~~~~~~-~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~L~~l~~~G~ir~iGvs~~~  165 (252)
                      |+||++.....+... ..+.+++++.++++.||+|||+||||+|++|+||...+.++++++|.+|+++|+||+||+||++
T Consensus        80 IaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~~  159 (316)
T COG0667          80 IATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYS  159 (316)
T ss_pred             EEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCCC
Confidence            999999876421111 3668999999999999999999999999999999989999999999999999999999999999


Q ss_pred             HHHHHHHhhc-CCceEEeeecCccccchhhhHHHHHHHhCCeEEecccCccccCCCCCCC
Q 025500          166 PGTIRRAHAV-HPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVV  224 (252)
Q Consensus       166 ~~~l~~~~~~-~~~~~~q~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~~~~  224 (252)
                      .+++.++++. .+++++|.+||++++..+.+++++|+++||++++||||++|+|++++..
T Consensus       160 ~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G~Ltgk~~~  219 (316)
T COG0667         160 AEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLTGKYLP  219 (316)
T ss_pred             HHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEEecCccccccCCCcCC
Confidence            9999999998 5999999999999987777799999999999999999999999999765

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
3v0u_A338 Crystal Structure Of Perakine Reductase, Founder Me 5e-95
3v0t_A337 Crystal Structure Of Perakine Reductase, Founder Me 5e-95
3uyi_A337 Crystal Structure Of Perakine Reductase, Founder Me 9e-95
3v0s_A337 Crystal Structure Of Perakine Reductase, Founder Me 2e-92
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 2e-29
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 3e-26
1pz1_A333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 6e-26
3n2t_A348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 6e-23
3eb3_A327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 1e-19
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 1e-19
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 2e-19
1exb_A332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 2e-19
3eau_A327 Voltage-Dependent K+ Channel Beta Subunit In Comple 2e-19
2a79_A333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 2e-19
3eb4_A327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 2e-19
3lut_A367 A Structural Model For The Full-Length Shaker Potas 2e-19
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 2e-18
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 4e-17
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 4e-17
2bp1_B360 Structure Of The Aflatoxin Aldehyde Reductase In Co 6e-15
2c91_A338 Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt 8e-15
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 1e-14
2clp_A347 Crystal Structure Of Human Aflatoxin B1 Aldehyde Re 1e-14
1gve_A327 Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live 1e-13
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 3e-11
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 3e-11
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 1e-10
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 2e-10
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 5e-10
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 1e-08
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 2e-08
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 3e-08
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 3e-08
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 3e-08
2alr_A324 Aldehyde Reductase Length = 324 5e-08
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 7e-08
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 1e-07
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 1e-07
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 1e-07
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 1e-07
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 2e-07
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 3e-07
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 3e-07
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 1e-06
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 3e-06
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 5e-06
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 1e-05
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 2e-05
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 5e-05
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 8e-05
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 9e-05
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 1e-04
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 1e-04
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 2e-04
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 4e-04
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 4e-04
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 4e-04
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 5e-04
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 5e-04
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 6e-04
4exa_A292 Crystal Structure Of The Pa4992, The Putative Aldo- 6e-04
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure 
Iteration: 1

 Score =  343 bits (880), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 164/229 (71%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
Query: 7   QVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQ 66
            +PRVKLGTQGLEVSKLG+GCM LSG Y+  + EE GI++IK AF+ GITFFDT+D+YG+
Sbjct: 1   HMPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGE 60
Query: 67  N-ANEVLLGKALKQLPREKIQVATKFXXXXXXXXXXXXXXXPDYVRSCCEASLKRLDVDY 125
           N +NE LLGKALKQLPREKIQV TKF               PDYVRSCCEASLKRLDVDY
Sbjct: 61  NGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDY 120
Query: 126 IDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEW 185
           IDL+Y HR+DT+VPIE T+GE+KKLVEEGKIKY+GLSEASP TIRRAHAVHP+TA+Q+E+
Sbjct: 121 IDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEY 180
Query: 186 SLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLV 234
           SLWTRDIE+EI+PLCR+LGIGIVPYSP+GRG F GKA+ E++P +S L 
Sbjct: 181 SLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKESLPENSVLT 229
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 Back     alignment and structure
>pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-136
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 1e-135
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-120
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 1e-112
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 1e-108
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 1e-102
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 9e-72
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 3e-69
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 5e-65
3erp_A353 Putative oxidoreductase; funded by the national in 6e-65
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 3e-63
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 1e-62
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 5e-57
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 1e-25
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 4e-25
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 3e-24
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 3e-24
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 4e-24
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 2e-23
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 2e-22
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 2e-22
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 2e-22
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 3e-22
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 3e-22
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 3e-22
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 6e-22
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 7e-22
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 8e-22
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 9e-22
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-21
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 1e-21
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 1e-21
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 4e-21
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 6e-21
4gie_A290 Prostaglandin F synthase; structural genomics, nia 8e-21
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-20
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-20
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
 Score =  384 bits (989), Expect = e-136
 Identities = 69/225 (30%), Positives = 114/225 (50%), Gaps = 3/225 (1%)

Query: 10  RVKLGTQGLEVSKLGYGCMNLSG-GYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNA 68
           + KLG   L+V  +G G   + G      ++EE G  +++ A   G+T  DTA +YG   
Sbjct: 3   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 62

Query: 69  NEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDL 128
           +E L+G+ L++  RE + +ATK           +   +PD+++   + SLKRL+ DYIDL
Sbjct: 63  SEELIGEVLREFNREDVVIATKAAHR-KQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDL 121

Query: 129 YYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLW 188
           +Y H  D   P +E +  + ++ + GKI+ IG+S  S   ++ A+    +  +Q E++L 
Sbjct: 122 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 181

Query: 189 TRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGK-AVVENVPADSF 232
            R+ E+   P  +E  I  +PY PL  G   GK       P    
Sbjct: 182 NREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGDL 226
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.79
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 95.49
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 95.14
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 95.12
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 95.1
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 95.1
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 95.02
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 95.0
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 94.86
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 94.63
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 94.56
2qgy_A391 Enolase from the environmental genome shotgun sequ 94.51
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 94.43
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 94.24
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 94.24
2o56_A407 Putative mandelate racemase; dehydratase, structur 94.21
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 94.15
3eez_A378 Putative mandelate racemase/muconate lactonizing e 93.92
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 93.87
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 93.73
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 93.72
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 93.7
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 93.69
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 93.59
2poz_A392 Putative dehydratase; octamer, structural genomics 93.57
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 93.56
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 93.55
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 93.42
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 93.39
2gl5_A410 Putative dehydratase protein; structural genomics, 93.35
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 93.29
3r0u_A379 Enzyme of enolase superfamily; structural genomics 92.95
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 92.91
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 92.82
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 92.78
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 92.76
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 92.66
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 92.61
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 92.47
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 92.4
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 92.24
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 92.22
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 92.15
1tzz_A392 Hypothetical protein L1841; structural genomics, m 91.9
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 91.84
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 91.78
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 91.71
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 91.67
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 91.62
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 91.32
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 91.19
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 91.06
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 90.98
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 90.88
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 90.76
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 90.7
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 90.69
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 90.38
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 89.59
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 89.58
2oz8_A389 MLL7089 protein; structural genomics, unknown func 89.18
3va8_A445 Probable dehydratase; enolase, magnesium binding s 89.0
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 88.74
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 88.63
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 88.58
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 88.51
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 88.37
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 88.36
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 87.84
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 87.81
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 87.74
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 87.52
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 87.49
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 87.38
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 87.36
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 87.36
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 86.91
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 86.82
1ydn_A 295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 86.58
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 86.48
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 85.85
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 85.34
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 85.07
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 84.63
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 84.28
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 84.25
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 84.06
2ftp_A 302 Hydroxymethylglutaryl-COA lyase; structural genomi 84.04
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 83.76
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 83.67
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 83.21
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 83.0
3qy7_A262 Tyrosine-protein phosphatase YWQE; TIM barrel, pol 82.4
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 81.47
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 81.34
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 81.34
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 80.46
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 80.18
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-56  Score=394.15  Aligned_cols=214  Identities=75%  Similarity=1.269  Sum_probs=192.4

Q ss_pred             cCceecCCCCccccceeecccccCCCCCCCCCHHHHHHHHHHHHHCCCCEEeCcCCcCC-CcHHHHHHHHHhcCCCCCEE
Q 025500            8 VPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQ-NANEVLLGKALKQLPREKIQ   86 (252)
Q Consensus         8 m~~~~lg~~g~~vs~lglG~~~~g~~~~~~~~~~~~~~~l~~A~~~Gin~~Dta~~Yg~-g~se~~ig~~l~~~~R~~~~   86 (252)
                      |+||+||++|++||+||||||++|+.|+...+.+++.+++++|++.|||+||||+.||+ |.+|+.+|++|+..+|+++|
T Consensus         1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~G~sE~~lG~al~~~~R~~~~   80 (337)
T 3v0s_A            1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREXIQ   80 (337)
T ss_dssp             CCEEECSSSSCEEESSCEECGGGC-------CHHHHHHHHHHHHHTTCCEEECCTTSSSTTHHHHHHHHHHTTSCGGGCE
T ss_pred             CCeeecCCCCceecCeeecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEEChhhhCCCCcHHHHHHHHHhhcCCcceE
Confidence            78999999999999999999999877776568899999999999999999999999997 68999999999976899999


Q ss_pred             EEeccCccCCCCcccccCCChHHHHHHHHHHHHHcCCCcccEEEccCCCCCCCHHHHHHHHHHHHHcCCccEEEccCCCH
Q 025500           87 VATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASP  166 (252)
Q Consensus        87 i~tK~~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~L~~l~~~G~ir~iGvs~~~~  166 (252)
                      |+||++......+....+.+++.+++++++||+|||+||||+|++|||+...+.+++|++|++|+++|+||+||||||+.
T Consensus        81 i~TK~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~  160 (337)
T 3v0s_A           81 VGTKFGIHEIGFSGVKAXGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXXLVEEGKIXYVGLSEASP  160 (337)
T ss_dssp             EEEEECEEEEETTEEEECCCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEESCCH
T ss_pred             EEeeeccccCCCCcccCCCCHHHHHHHHHHHHHHhCCCCeeEEEecCCCCCCCHHHHHHHHHHHHHCCCeeEEeccCCCH
Confidence            99999875422122334678999999999999999999999999999999889999999999999999999999999999


Q ss_pred             HHHHHHhhcCCceEEeeecCccccchhhhHHHHHHHhCCeEEecccCccccCCCC
Q 025500          167 GTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGK  221 (252)
Q Consensus       167 ~~l~~~~~~~~~~~~q~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~  221 (252)
                      ++++++.+..+++++|++||++++..+.+++++|+++||+|++|+||++|+|+++
T Consensus       161 ~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~L~g~  215 (337)
T 3v0s_A          161 DTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGK  215 (337)
T ss_dssp             HHHHHHHHHSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTHHHHHHHH
T ss_pred             HHHHHHhccCCceEEEeeccccccchhHHHHHHHHHcCceEEEeccccCcccCCC
Confidence            9999999989999999999999998778899999999999999999999999875
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3qy7_A Tyrosine-protein phosphatase YWQE; TIM barrel, polymerase and histindinol phosphatase(PHP)-like phosphatase, hydrolase; 1.62A {Bacillus subtilis} PDB: 3qy6_A Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 4e-49
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 1e-48
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 2e-43
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 1e-37
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 2e-36
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-35
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 8e-35
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 9e-35
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-34
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-33
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-32
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-30
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 2e-30
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 9e-28
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 6e-27
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-24
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

 Score =  162 bits (409), Expect = 4e-49
 Identities = 70/224 (31%), Positives = 112/224 (50%), Gaps = 2/224 (0%)

Query: 10  RVKLGTQGLEVSKLGYGCMNLSG-GYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNA 68
           + KLG   L+V  +G G   + G      ++EE G  +++ A   G+T  DTA +YG   
Sbjct: 2   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 61

Query: 69  NEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDL 128
           +E L+G+ L++  RE + +ATK      G   V         +S  E SLKRL+ DYIDL
Sbjct: 62  SEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDE-SLKRLNTDYIDL 120

Query: 129 YYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLW 188
           +Y H  D   P +E +  + ++ + GKI+ IG+S  S   ++ A+    +  +Q E++L 
Sbjct: 121 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 180

Query: 189 TRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSF 232
            R+ E+   P  +E  I  +PY PL  G   GK   +    +  
Sbjct: 181 NREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGD 224
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 94.31
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 94.26
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 93.39
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 93.34
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 92.62
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 92.2
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 91.95
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 91.56
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 91.18
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 90.19
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 89.66
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 87.12
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 83.83
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 81.75
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=9e-51  Score=352.10  Aligned_cols=215  Identities=32%  Similarity=0.598  Sum_probs=198.5

Q ss_pred             CceecCCCCccccceeecccccCCC-CCCCCCHHHHHHHHHHHHHCCCCEEeCcCCcCCCcHHHHHHHHHhcCCCCCEEE
Q 025500            9 PRVKLGTQGLEVSKLGYGCMNLSGG-YSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQV   87 (252)
Q Consensus         9 ~~~~lg~~g~~vs~lglG~~~~g~~-~~~~~~~~~~~~~l~~A~~~Gin~~Dta~~Yg~g~se~~ig~~l~~~~R~~~~i   87 (252)
                      ++|+||+||++||+||||||++|+. ++...+++++.++|++|++.|||+||||+.||+|.+|+.+|++++..+|++++|
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~sE~~lg~~l~~~~r~~~~i   80 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVI   80 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEE
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCccHHHHhhhhhcccccceec
Confidence            4799999999999999999999863 334468999999999999999999999999999999999999999888999999


Q ss_pred             EeccCccCCCCcccccCCChHHHHHHHHHHHHHcCCCcccEEEccCCCCCCCHHHHHHHHHHHHHcCCccEEEccCCCHH
Q 025500           88 ATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPG  167 (252)
Q Consensus        88 ~tK~~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~L~~l~~~G~ir~iGvs~~~~~  167 (252)
                      +||++..... .....+.+++.+++++++||+||++||+|++++|+|+...+.+++|++|++++++|+||+||+|+++.+
T Consensus        81 ~tK~~~~~~~-~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~~  159 (311)
T d1pyfa_          81 ATKAAHRKQG-NDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLE  159 (311)
T ss_dssp             EEEECEEEET-TEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHH
T ss_pred             ceeccCCCCC-cccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcHH
Confidence            9999876532 223456889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCceEEeeecCccccchhhhHHHHHHHhCCeEEecccCccccCCCCCCC
Q 025500          168 TIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVV  224 (252)
Q Consensus       168 ~l~~~~~~~~~~~~q~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~~~~  224 (252)
                      .+.++.+..+++++|++||+.++..+.+++++|+++||++++|+||++|+|++++..
T Consensus       160 ~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~~~~~~  216 (311)
T d1pyfa_         160 QLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTE  216 (311)
T ss_dssp             HHHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTCCCT
T ss_pred             HHHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCccCCCcCc
Confidence            999999999999999999999998778999999999999999999999999999553
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure