Citrus Sinensis ID: 025508


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MAATSDDGMESLLSDFDQIYEDFKRAISEVQLLRSSCNAETKRREALEITCNTLKKENERARNSYTESLENLADQLERKAKCQSLKEELKRVNDEHLSKEYELRKVIDSIKQDYAAKARDFEDQIRSLMLEKATNEATISNLHQDLAAHKMHMQTLAKKLDQVKFDVEMKYNLEIQDLKDCLLLEQEEKNELNKRVQDLEKELLMNRTKMAEHNRDLTSVRSVETLKLKIMKLRKENEILKRKLNSSSQEG
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
**************DFDQIYEDFKRAISEVQLLRS*************IT***************************************************ELRKVIDSIKQDYAAKARDFEDQIRSLMLE*****ATISNLHQDLAAHKMHMQTLAKKLDQVKFDVEMKYNLEIQDLKDCLLLE******************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATSDDGMESLLSDFDQIYEDFKRAISEVQLLRSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRKVIDSIxxxxxxxxxxxxxxxxxxxxxKATNEATISNLHQDLAAHKMHMQTLAKKLDQVKFDVEMKYNLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTSVRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein At-4/1 Involved in intra- and inter-cellular trafficking through plasmodesmata (PD).probableQ1PE49

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 29-62
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 112-168
View the alignment between query and template
View the model in PyMOL
Template: 3OJA, chain B
Confidence level:probable
Coverage over the Query: 118-204
View the alignment between query and template
View the model in PyMOL
Template: 3SWK, chain A
Confidence level:probable
Coverage over the Query: 8-61,72-92
View the alignment between query and template
View the model in PyMOL
Template: 1C1G, chain A
Confidence level:probable
Coverage over the Query: 224-244
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3ol1, chain Aprobable Alignment | Template Structure