Citrus Sinensis ID: 025509

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MDIVITGATSGIGTETARVLALRGVHVVMGVRDIAAGKDVKETIVKEIPSAKVDAMELDLSSLASVRNFASEYNIQHHQLNILINNAGIMGTPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKKTARKSGGEGRIINVSSEGHRLAYHEGIRFDKINDPSGYNGFRAYSQSKLANILHANELARRLKEDGVDITANSVHPGAIATNIIRHNSLFRSMNTILHALPGIAGKCLLKNVQQVILNFQKQRNKI
cEEEEEccccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccEEEEccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEECccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
MDIVITGATSGIGTETARVLALRGVHVVMGVRDIAAGKDVKETIVKEIPSAKVDAMELDLSSLASVRNFASEYNIQHHQLNILINNAGIMGTPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKKTARKSGGEGRIINVSSEGHRLAYHEGIRFDKINDPSGYNGFRAYSQSKLANILHANELARRLKEDGVDITANSVHPGAIATNIIRHNSLFRSMNTILHALPGIAGKCLLKNVQQVILNFQ******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIVITGATSGIGTETARVLALRGVHVVMGVRDIAAGKDVKETIVKEIPSAKVDAMELDLSSLASVRNFASEYNIQHHQLNILINNAGIMGTPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKKTARKSGGEGRIINVSSEGHRLAYHEGIRFDKINDPSGYNGFRAYSQSKLANILHANELARRLKEDGVDITANSVHPGAIATNIIRHNSLFRSMNTILHALPGIAGKCLLKNVQQVILNFQKQRNKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Short-chain dehydrogenase TIC 32, chloroplastic Involved in protein precursor import into chloroplasts. Part of the redox regulon consisting of TIC32, TIC 55 and TIC62. Has a NADPH-dependent dehydrogenase activity, but only after preincubation with lipids.probableQ6RVV4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 1-208
View the alignment between query and template
View the model in PyMOL
Template: 4FGS, chain A
Confidence level:very confident
Coverage over the Query: 1-146,162-243
View the alignment between query and template
View the model in PyMOL