Citrus Sinensis ID: 025543

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
ccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHccc
ccccEEEcccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHcccccEccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHccH
mgkglipadldTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLegedsrggnsiELDLEAEFSSLALDIIGlgvfnydfgsvtkespvIKAVYGTLfeaehrstfyipywkiplarwivprQRKFQNDLKIINDCLDGLIRNAKETRQETDVeklqsrdysnlkdASLLRFLVDmrgadvddrQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDsvlgqkkptfeslkkle
mgkglipadldtwkqRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRnaketrqetdveklqsrdysnlkdASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAevdsvlgqkkptfeslkkle
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
******PADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLE********SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRN********************LKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQ******************************
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLE*****GGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIR*********************LKDASL***************QLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKE************RDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPS*********DSVLGQKKPT********
*GKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
O48921 576 Cytochrome P450 97B2, chl yes no 1.0 0.435 0.892 1e-129
Q43078 552 Cytochrome P450 97B1, chl N/A no 1.0 0.454 0.864 1e-126
O23365 580 Cytochrome P450 97B3, chl yes no 1.0 0.432 0.837 1e-123
Q93VK5 595 Protein LUTEIN DEFICIENT no no 0.956 0.403 0.507 2e-60
Q6TBX7 539 Carotene epsilon-monooxyg no no 0.964 0.448 0.440 5e-52
O08336 1054 Probable bifunctional P-4 yes no 0.852 0.203 0.302 6e-23
P14779 1049 Bifunctional P-450/NADPH- yes no 0.832 0.199 0.269 2e-19
Q8N118 509 Cytochrome P450 4X1 OS=Ho yes no 0.908 0.447 0.269 5e-18
Q9Y8G7 1066 Bifunctional P-450:NADPH- N/A no 0.856 0.201 0.286 5e-18
O08394 1061 Probable bifunctional P-4 no no 0.852 0.201 0.283 8e-18
>sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 Back     alignment and function desciption
 Score =  461 bits (1187), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/251 (89%), Positives = 234/251 (93%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGN 60
           MGKGLIPADLDTWKQRRRVIAP FH  YLEAMV +F  CSERTI+KF KLLEGE   G +
Sbjct: 151 MGKGLIPADLDTWKQRRRVIAPAFHNSYLEAMVKIFTTCSERTILKFNKLLEGEGYDGPD 210

Query: 61  SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 120
           SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI
Sbjct: 211 SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 270

Query: 121 PLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFL 180
           PLARWIVPRQRKFQ+DLK+IN CLDGLIRNAKE+RQETDVEKLQ RDY NLKDASLLRFL
Sbjct: 271 PLARWIVPRQRKFQDDLKVINTCLDGLIRNAKESRQETDVEKLQQRDYLNLKDASLLRFL 330

Query: 181 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQK 240
           VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSK+KKAQAEVD VLG  
Sbjct: 331 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKMKKAQAEVDLVLGTG 390

Query: 241 KPTFESLKKLE 251
           +PTFESLK+L+
Sbjct: 391 RPTFESLKELQ 401

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 Back     alignment and function description
>sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=1 SV=2 Back     alignment and function description
>sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 Back     alignment and function description
>sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 Back     alignment and function description
>sp|O08336|CYPE_BACSU Probable bifunctional P-450/NADPH-P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypE PE=2 SV=1 Back     alignment and function description
>sp|P14779|CPXB_BACME Bifunctional P-450/NADPH-P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 Back     alignment and function description
>sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 Back     alignment and function description
>sp|O08394|CYPD_BACSU Probable bifunctional P-450/NADPH-P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
225464788 572 PREDICTED: cytochrome P450 97B2, chlorop 1.0 0.438 0.896 1e-130
255559122 555 cytochrome P450, putative [Ricinus commu 1.0 0.452 0.892 1e-130
351724791 576 cytochrome P450 97B2, chloroplastic [Gly 1.0 0.435 0.892 1e-128
357481377 574 Cytochrome P450 [Medicago truncatula] gi 1.0 0.437 0.872 1e-126
224089583 579 cytochrome P450 [Populus trichocarpa] gi 1.0 0.433 0.852 1e-124
5915854 552 RecName: Full=Cytochrome P450 97B1, chlo 1.0 0.454 0.864 1e-124
449459994 580 PREDICTED: cytochrome P450 97B2, chlorop 1.0 0.432 0.848 1e-122
449514617 580 PREDICTED: cytochrome P450 97B2, chlorop 1.0 0.432 0.848 1e-122
2244868 576 cytochrome P450 like protein [Arabidopsi 1.0 0.435 0.837 1e-121
30683137 580 cytochrome P450 97B3 [Arabidopsis thalia 1.0 0.432 0.837 1e-121
>gi|225464788|ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera] gi|296087528|emb|CBI34117.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/251 (89%), Positives = 238/251 (94%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGN 60
           MGKGLIPADLDTWKQRRRVIAPGFHALYLEAM  +F +CSER I+KFEKLLEGE   GG 
Sbjct: 148 MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMTKVFTECSERAILKFEKLLEGEHLHGGK 207

Query: 61  SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 120
           +IELDLEAEFS+LALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWK+
Sbjct: 208 TIELDLEAEFSNLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKV 267

Query: 121 PLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFL 180
           PLARWIVPRQRKF +DLK+INDCLDGLI+NAKETRQETDVEKLQ RDY NLKDASLLRFL
Sbjct: 268 PLARWIVPRQRKFHSDLKVINDCLDGLIKNAKETRQETDVEKLQQRDYQNLKDASLLRFL 327

Query: 181 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQK 240
           VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSK+KKAQAE+DSVLGQ 
Sbjct: 328 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKMKKAQAEIDSVLGQG 387

Query: 241 KPTFESLKKLE 251
           + +FESLKKLE
Sbjct: 388 RISFESLKKLE 398

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255559122|ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis] gi|223540243|gb|EEF41816.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351724791|ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max] gi|5915855|sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor gi|2738996|gb|AAB94586.1| CYP97B2p [Glycine max] Back     alignment and taxonomy information
>gi|357481377|ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula] gi|355512309|gb|AES93932.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224089583|ref|XP_002308766.1| cytochrome P450 [Populus trichocarpa] gi|222854742|gb|EEE92289.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|5915854|sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome P450 97A2; Flags: Precursor gi|1360118|emb|CAA89260.1| cytochrome P450 [Pisum sativum] Back     alignment and taxonomy information
>gi|449459994|ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449514617|ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|2244868|emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana] gi|7268257|emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30683137|ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana] gi|21542391|sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor gi|17065198|gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana] gi|27311953|gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana] gi|332658157|gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2129695 580 CYP97B3 ""cytochrome P450, fam 1.0 0.432 0.837 3.3e-111
TAIR|locus:2034476 595 CYP97A3 ""cytochrome P450, fam 0.952 0.401 0.513 6.6e-58
TAIR|locus:2102023 539 LUT1 "LUTEIN DEFICIENT 1" [Ara 0.960 0.447 0.446 5.8e-50
UNIPROTKB|Q8N118 509 CYP4X1 "Cytochrome P450 4X1" [ 0.956 0.471 0.271 9e-20
UNIPROTKB|E1BYW5 530 CYP4V2 "Uncharacterized protei 0.940 0.445 0.290 4.6e-19
TIGR_CMR|BA_3221 1065 BA_3221 "bifunctional P-450:NA 0.681 0.160 0.354 4.7e-19
UNIPROTKB|P98187 520 CYP4F8 "Cytochrome P450 4F8" [ 0.928 0.448 0.257 1.5e-18
UNIPROTKB|Q66HK8 524 Cyp4f1 "Cytochrome P450, famil 0.924 0.442 0.260 1.5e-18
RGD|70926 524 Cyp4f1 "cytochrome P450, famil 0.924 0.442 0.260 2e-18
RGD|2480 511 Cyp4b1 "cytochrome P450, famil 0.948 0.465 0.271 2.4e-18
TAIR|locus:2129695 CYP97B3 ""cytochrome P450, family 97, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1098 (391.6 bits), Expect = 3.3e-111, P = 3.3e-111
 Identities = 211/252 (83%), Positives = 229/252 (90%)

Query:     1 MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLL-EGEDSRGG 59
             MGKGLIPADLDTWK RRR I P FH LYLEAMV +F+DCSE+ I+K EKL+ E E S G 
Sbjct:   156 MGKGLIPADLDTWKLRRRAITPAFHKLYLEAMVKVFSDCSEKMILKSEKLIREKETSSGE 215

Query:    60 NSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWK 119
             ++IELDLEAEFSSLALDIIGL VFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFY PYW 
Sbjct:   216 DTIELDLEAEFSSLALDIIGLSVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYFPYWN 275

Query:   120 IPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRF 179
              P ARWIVPRQRKFQ+DLKIINDCLDGLI+NAKETRQETDVEKLQ RDY+NLKDASLLRF
Sbjct:   276 FPPARWIVPRQRKFQSDLKIINDCLDGLIQNAKETRQETDVEKLQERDYTNLKDASLLRF 335

Query:   180 LVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQ 239
             LVDMRG D+DDRQLRDDLMTMLIAGHETTAAVLTWAVFLL+QNP K++KAQAE+D+VLGQ
Sbjct:   336 LVDMRGVDIDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLSQNPEKIRKAQAEIDAVLGQ 395

Query:   240 KKPTFESLKKLE 251
               PT+ES+KKLE
Sbjct:   396 GPPTYESMKKLE 407
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
TAIR|locus:2034476 CYP97A3 ""cytochrome P450, family 97, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102023 LUT1 "LUTEIN DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N118 CYP4X1 "Cytochrome P450 4X1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3221 BA_3221 "bifunctional P-450:NADPH-P450 reductase 1" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P98187 CYP4F8 "Cytochrome P450 4F8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q66HK8 Cyp4f1 "Cytochrome P450, family 4, subfamily F, polypeptide 2, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|70926 Cyp4f1 "cytochrome P450, family 4, subfamily f, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2480 Cyp4b1 "cytochrome P450, family 4, subfamily b, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O48921C97B2_SOYBN1, ., 1, 4, ., -, ., -0.89241.00.4357yesno
O23365C97B3_ARATH1, ., 1, 4, ., -, ., -0.83731.00.4327yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP97B7
cytochrome P450 (529 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00121060
cytochrome P450 (114 aa)
  •     0.478
fgenesh4_pg.C_scaffold_18069000001
annotation not avaliable (161 aa)
  •     0.418

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-85
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 6e-81
pfam00067 461 pfam00067, p450, Cytochrome P450 6e-27
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-21
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-15
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 3e-12
PLN02169 500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 6e-12
PLN02426 502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-09
PLN02302 490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-07
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 7e-07
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-05
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-05
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 2e-05
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-05
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-04
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-04
PLN02500 490 PLN02500, PLN02500, cytochrome P450 90B1 6e-04
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 0.002
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 0.003
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information 
 Score =  265 bits (678), Expect = 4e-85
 Identities = 128/253 (50%), Positives = 166/253 (65%), Gaps = 14/253 (5%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKL-LEGEDSRGG 59
           MGKGLIPAD + W+ RRR I P  H  Y+ AM+++F   S+R   K +    +GED    
Sbjct: 210 MGKGLIPADGEIWRVRRRAIVPALHQKYVAAMISLFGQASDRLCQKLDAAASDGED---- 265

Query: 60  NSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWK 119
               +++E+ FS L LDIIG  VFNYDF S++ ++ +++AVY  L EAE RS   IP W+
Sbjct: 266 ----VEMESLFSRLTLDIIGKAVFNYDFDSLSNDTGIVEAVYTVLREAEDRSVSPIPVWE 321

Query: 120 IPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRD-YSNLKDASLLR 178
           IP+ + I PRQRK    LK+IND LD LI   K   +E   E+LQ  + Y N +D S+L 
Sbjct: 322 IPIWKDISPRQRKVAEALKLINDTLDDLIAICKRMVEE---EELQFHEEYMNERDPSILH 378

Query: 179 FLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLG 238
           FL+   G DV  +QLRDDLMTMLIAGHET+AAVLTW  +LL++ PS V K Q EVDSVLG
Sbjct: 379 FLL-ASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKEPSVVAKLQEEVDSVLG 437

Query: 239 QKKPTFESLKKLE 251
            + PT E +KKL+
Sbjct: 438 DRFPTIEDMKKLK 450

Length = 633
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
PLN02738 633 carotene beta-ring hydroxylase 100.0
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02936 489 epsilon-ring hydroxylase 100.0
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.97
PLN02290 516 cytokinin trans-hydroxylase 99.97
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
PLN02971 543 tryptophan N-hydroxylase 99.97
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.97
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.97
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.97
PTZ00404 482 cytochrome P450; Provisional 99.97
PLN02687 517 flavonoid 3'-monooxygenase 99.97
PLN03112 514 cytochrome P450 family protein; Provisional 99.96
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.96
PLN03234 499 cytochrome P450 83B1; Provisional 99.96
PLN02183 516 ferulate 5-hydroxylase 99.96
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PLN02966 502 cytochrome P450 83A1 99.96
PLN02394 503 trans-cinnamate 4-monooxygenase 99.96
PLN02500 490 cytochrome P450 90B1 99.95
PLN03018 534 homomethionine N-hydroxylase 99.95
PLN00168 519 Cytochrome P450; Provisional 99.95
PLN02655 466 ent-kaurene oxidase 99.95
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.95
PLN02196 463 abscisic acid 8'-hydroxylase 99.93
PLN02774 463 brassinosteroid-6-oxidase 99.93
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.93
PLN02302 490 ent-kaurenoic acid oxidase 99.92
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.9
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.88
PLN02648 480 allene oxide synthase 99.85
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.74
PF1255448 MOZART1: Mitotic-spindle organizing gamma-tubulin 89.6
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information 
Probab=100.00  E-value=2e-33  Score=241.32  Aligned_cols=240  Identities=50%  Similarity=0.827  Sum_probs=170.8

Q ss_pred             CcccccCCCchHHhhhhcccCCCchHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCccccHHHHHHHHHHHHHHhh
Q 025543            2 GKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLG   81 (251)
Q Consensus         2 g~gi~~~~g~~wk~~Rr~~~~~f~~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~vd~~~~~~~~t~dvi~~~   81 (251)
                      |.|+++.+|+.||++|++++++|+..++..+.+.+.++++.++++|.+....+       .++|+...+..+|+|||+.+
T Consensus       211 g~~l~~~dge~wr~rRr~l~p~Fs~~~v~~l~~~i~~~v~~L~~~L~~~~~~g-------~~vdl~~~~~~lt~DVI~~~  283 (633)
T PLN02738        211 GKGLIPADGEIWRVRRRAIVPALHQKYVAAMISLFGQASDRLCQKLDAAASDG-------EDVEMESLFSRLTLDIIGKA  283 (633)
T ss_pred             CCceecCCcHHHHHHHHhccHhhhHHHHHHHHHHHHHHHHHHHHHHHHHhcCC-------CcEeHHHHHHHHHHHHHHHH
Confidence            56888899999999999999999999999999999999999999987644332       38999999999999999999


Q ss_pred             hhccccCCCCCCChhHHHHHHHHHHhhhhhcccccccchhhhhhhcchhhhhHHHHHHHHHHHHHHHHHHHHHhhhhhHH
Q 025543           82 VFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVE  161 (251)
Q Consensus        82 ~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (251)
                      +||.+++....+..+...+...+..........++.|.+|.+..+.++.++..+..+.+...+..+++.+..........
T Consensus       284 ~FG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~l~~~~~~~~~~~~~l~~~~~~li~~~~~~~~~~~~~  363 (633)
T PLN02738        284 VFNYDFDSLSNDTGIVEAVYTVLREAEDRSVSPIPVWEIPIWKDISPRQRKVAEALKLINDTLDDLIAICKRMVEEEELQ  363 (633)
T ss_pred             HhCCCccccccchHHHHHHHHHHHHHHHHhhcchhhhhhhHHhhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            99999875443334444444443322211112223333444333333333333444455555555555433221110000


Q ss_pred             HhhhhccccccchhHHHHHHHhcCCCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhcCchHHHHHHHHHHHhhCCCC
Q 025543          162 KLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKK  241 (251)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~i~~~~~~~~~AG~dTta~~l~~~~~~L~~~P~vq~kl~~Ei~~v~~~~~  241 (251)
                        .........+.++++.+++. +..++++++.+++.++++||+||||++|+|++|+|++||++|+|||+||+++++++.
T Consensus       364 --~~~~~~~~~~~dil~~Ll~~-~~~ls~~~L~~e~~~ll~AG~eTTA~tLt~~l~~L~~~Pevq~kLreEl~~v~~~~~  440 (633)
T PLN02738        364 --FHEEYMNERDPSILHFLLAS-GDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKEPSVVAKLQEEVDSVLGDRF  440 (633)
T ss_pred             --chhcccccccchHHHHHHHc-CCCCCHHHHHHHHHHHHhcCCccHHHHHHHHHHHHHhCHHHHHHHHHHHHHhcCCCC
Confidence              00000011234688888764 346899999999999999999999999999999999999999999999999998777


Q ss_pred             CChhhhccCC
Q 025543          242 PTFESLKKLE  251 (251)
Q Consensus       242 ~~~~dl~~Lp  251 (251)
                      |+++++++||
T Consensus       441 ~t~edL~kLP  450 (633)
T PLN02738        441 PTIEDMKKLK  450 (633)
T ss_pred             CCHHHHccCH
Confidence            9999999987

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF12554 MOZART1: Mitotic-spindle organizing gamma-tubulin ring associated; InterPro: IPR022214 This family of proteins is found in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
3ben_A 470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-20
3hf2_A 482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-20
2ij2_A 470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-20
1zo4_A 473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-20
1zoa_A 473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-20
1p0w_A 455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-20
1jpz_A 473 Crystal Structure Of A Complex Of The Heme Domain O 1e-20
2hpd_A 471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-20
3kx3_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-20
2nnb_A 471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-20
2bmh_A 455 Modeling Protein-Substrate Interactions In The Heme 1e-20
1bvy_A 458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-20
1p0x_A 455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-20
1p0v_A 455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-20
2x7y_A 455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-20
3kx4_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-20
1jme_A 455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-20
2uwh_A 458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 1e-20
3m4v_A 482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-20
3kx5_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-20
4dud_A 471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 3e-20
4duc_A 472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 3e-20
4duf_A 471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 3e-20
3psx_A 487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-20
3ekb_A 470 Crystal Structure Of The A264c Mutant Heme Domain O 4e-20
1yqp_A 455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 4e-20
1yqo_A 455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-20
3dgi_A 461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 4e-20
1fah_A 471 Structure Of Cytochrome P450 Length = 471 4e-20
3ekd_A 470 Crystal Structure Of The A264m Heme Domain Of Cytoc 5e-20
2ij3_A 470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 5e-20
3ekf_A 470 Crystal Structure Of The A264q Heme Domain Of Cytoc 5e-20
2ij4_A 470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 5e-20
1smi_A 471 A Single Mutation Of P450 Bm3 Induces The Conformat 5e-20
3npl_A 470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 5e-20
4dtw_B 469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-19
3qi8_B 472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-19
4dub_A 472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-19
4dua_A 471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-19
4du2_B 470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 3e-19
3cbd_A 455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-18
2q9f_A 456 Crystal Structure Of Human Cytochrome P450 46a1 In 1e-09
3ua1_A 487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 8e-09
1tqn_A 486 Crystal Structure Of Human Microsomal P450 3a4 Leng 9e-09
1w0e_A 485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 9e-09
3dbg_A 467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 6e-07
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-05
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-04
3eqm_A 503 Crystal Structure Of Human Placental Aromatase Cyto 4e-04
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure 
Iteration: 1

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 124/249 (49%), Gaps = 40/249 (16%)
Query: 12  TWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFS 71
            WK+   ++ P F    ++    M  D + + + K+E+L   E         +++  + +
Sbjct: 96  NWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADE--------HIEVPEDMT 147
Query: 72  SLALDIIGLGVFNYDFGSVTKESP--VIKAVYGTLFEAEH---RSTFYIPYWKIPLARWI 126
            L LD IGL  FNY F S  ++ P   I ++   L EA +   R+    P +        
Sbjct: 148 RLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYD------- 200
Query: 127 VPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMR-- 184
              +R+FQ D+K++ND +D +I + K + +++D                LL  +++ +  
Sbjct: 201 -ENKRQFQEDIKVMNDLVDKIIADRKASGEQSD---------------DLLTHMLNGKDP 244
Query: 185 --GADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKP 242
             G  +DD  +R  ++T LIAGHETT+ +L++A++ L +NP  ++KA  E   VL    P
Sbjct: 245 ETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVP 304
Query: 243 TFESLKKLE 251
           +++ +K+L+
Sbjct: 305 SYKQVKQLK 313
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 7e-71
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-56
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 4e-52
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-43
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-40
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-40
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-39
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 6e-38
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 8e-34
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-32
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-30
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 8e-26
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-24
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-18
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-16
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-15
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 6e-15
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-12
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-11
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-11
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 7e-11
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 9e-11
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-10
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-10
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-10
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 4e-10
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-10
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-10
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 7e-10
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 5e-07
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 1e-06
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-06
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 1e-06
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-06
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 2e-06
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 3e-06
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 3e-06
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 3e-06
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 5e-06
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 5e-06
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 6e-06
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 7e-06
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 7e-06
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 7e-06
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 9e-06
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-05
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 2e-05
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 3e-05
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 3e-05
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 3e-05
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-05
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 4e-05
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 5e-05
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 5e-05
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 6e-05
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 7e-05
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 7e-05
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 9e-05
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 9e-05
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 9e-05
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 1e-04
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 2e-04
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 2e-04
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 2e-04
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-04
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-04
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 3e-04
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 3e-04
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 4e-04
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 5e-04
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 6e-04
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
 Score =  223 bits (571), Expect = 7e-71
 Identities = 69/258 (26%), Positives = 125/258 (48%), Gaps = 36/258 (13%)

Query: 1   MGKGLIPADLD--TWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRG 58
            G GL  +      WK+   ++ P F    ++    M  D + + + K+E+L   E    
Sbjct: 82  AGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADE---- 137

Query: 59  GNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKE--SPVIKAVYGTLFEAEHRSTFYIP 116
                +++  + + L LD IGL  FNY F S  ++   P I ++   L EA ++     P
Sbjct: 138 ----HIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANP 193

Query: 117 YWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASL 176
                        +R+FQ D+K++ND +D +I + K + +++D                L
Sbjct: 194 DDPAYD-----ENKRQFQEDIKVMNDLVDKIIADRKASGEQSD---------------DL 233

Query: 177 LRFLVDMR----GADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAE 232
           L  +++ +    G  +DD  +R  ++T LIAGHETT+ +L++A++ L +NP  ++KA  E
Sbjct: 234 LTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEE 293

Query: 233 VDSVLGQKKPTFESLKKL 250
              VL    P+++ +K+L
Sbjct: 294 AARVLVDPVPSYKQVKQL 311
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.98
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.97
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.97
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.97
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.96
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.96
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.96
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.96
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.96
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.96
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.96
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.95
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.95
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.95
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.94
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.94
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.93
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.93
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.91
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.91
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.91
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.9
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.9
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.9
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.9
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.9
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.9
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.89
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.89
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.89
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.89
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.89
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.89
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.89
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.89
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.89
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.88
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.88
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.88
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.88
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.88
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.88
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.88
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.88
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.88
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.88
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.88
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.87
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.87
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.87
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.87
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.87
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.87
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.87
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.87
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.86
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.86
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.86
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.86
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.86
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.85
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.85
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.85
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.85
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.85
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.84
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.84
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.82
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.8
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.77
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.77
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.75
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.32
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
Probab=99.98  E-value=6.6e-31  Score=219.29  Aligned_cols=227  Identities=25%  Similarity=0.432  Sum_probs=159.1

Q ss_pred             CcccccC-CCchHHhhhhcccCCCchHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCccccHHHHHHHHHHHHHHh
Q 025543            2 GKGLIPA-DLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGL   80 (251)
Q Consensus         2 g~gi~~~-~g~~wk~~Rr~~~~~f~~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~vd~~~~~~~~t~dvi~~   80 (251)
                      |.|+++. +|+.|+++||+++++|+.+.++.+.+.+.++++.+++.+.+....       +.++|+.+++..+++|+|+.
T Consensus        74 g~~~~~~~~g~~w~~~Rr~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~-------~~~vd~~~~~~~~~~dvi~~  146 (456)
T 3mdm_A           74 GQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADG-------QTPVSMQDMLTYTAMDILAK  146 (456)
T ss_dssp             TTSTTTCCCHHHHHHHHHHHGGGGSHHHHHTTHHHHHHHHHHHHHHHHHTCSS-------SSCEEHHHHHHHHHHHHHHH
T ss_pred             CCCcccCCChHHHHHHHhhcccccCHHHHHHHHHHHHHHHHHHHHHHHHhcCC-------CCeeeHHHHHHHHHHHHHHH
Confidence            5677765 899999999999999999999999999999999999988653222       23899999999999999999


Q ss_pred             hhhccccCCCCCCC-hhHHHHHHHHHHhhhhhcccccccchhhhhhhcchhhhhHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 025543           81 GVFNYDFGSVTKES-PVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETD  159 (251)
Q Consensus        81 ~~fG~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (251)
                      ++||.+++.+.... ++...+...+..... ....+..+ +|....   ..+...+..+.+..++.+.++++++....  
T Consensus       147 ~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-~p~~~~---~~~~~~~~~~~~~~~~~~~i~~r~~~~~~--  219 (456)
T 3mdm_A          147 AAFGMETSMLLGAQKPLSQAVKLMLEGITA-SRNTLAKF-LPGKRK---QLREVRESIRFLRQVGRDWVQRRREALKR--  219 (456)
T ss_dssp             HHHSCCCCGGGTCCHHHHHHHHHHHHHHHH-HHHSCGGG-CGGGHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHT--
T ss_pred             HHcCCChhhhcccccHHHHHHHHHHHHHHH-HHHHHHHh-CchhHH---HHHHHHHHHHHHHHHHHHHHHHHHHHhhc--
Confidence            99999887554332 222332222222111 00111111 221100   01122223333444444444443322110  


Q ss_pred             HHHhhhhccccccchhHHHHHHHhcCCCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhcCchHHHHHHHHHHHhhCC
Q 025543          160 VEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQ  239 (251)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~i~~~~~~~~~AG~dTta~~l~~~~~~L~~~P~vq~kl~~Ei~~v~~~  239 (251)
                            .   .....++++.++...+..++++++.+++.++++||+|||+++|+|++|+|++||++|+|+++||++++|+
T Consensus       220 ------~---~~~~~d~l~~ll~~~~~~~~~~~l~~~~~~l~~AG~dTTa~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~  290 (456)
T 3mdm_A          220 ------G---EEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGS  290 (456)
T ss_dssp             ------T---CCCCCCHHHHHHHHTSSCSSSHHHHHHHHHHHHHTTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTT
T ss_pred             ------c---ccchhhHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHcCC
Confidence                  0   0112368888876655568899999999999999999999999999999999999999999999999986


Q ss_pred             -CCCChhhhccCC
Q 025543          240 -KKPTFESLKKLE  251 (251)
Q Consensus       240 -~~~~~~dl~~Lp  251 (251)
                       +.++++|+.+||
T Consensus       291 ~~~~~~~~l~~lp  303 (456)
T 3mdm_A          291 KRYLDFEDLGRLQ  303 (456)
T ss_dssp             CSSCCHHHHHHCH
T ss_pred             CCCCCHHHHhcCH
Confidence             579999999886
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 8e-20
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 9e-13
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-09
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 85.5 bits (210), Expect = 8e-20
 Identities = 41/251 (16%), Positives = 85/251 (33%), Gaps = 14/251 (5%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGN 60
            G G+I A+ + W+  RR          +          S    ++ E     E+ R   
Sbjct: 82  QGYGVIFANGERWRALRRFSLATMRDFGMGKR-------SVEERIQEEARCLVEELRKSK 134

Query: 61  SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 120
              LD    F S+  +II   VF   F         +  ++   F      +  +     
Sbjct: 135 GALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFS 194

Query: 121 PLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFL 180
              +      R+   +L+ IN  +   +   + T   ++                 +   
Sbjct: 195 GFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLL------RMEKD 248

Query: 181 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQK 240
                ++   + L   ++++  AG ETT+  L +   L+ + P   ++ Q E++ V+G  
Sbjct: 249 KSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSH 308

Query: 241 K-PTFESLKKL 250
           + P  +   K+
Sbjct: 309 RPPALDDRAKM 319
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.94
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.93
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.91
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.9
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.88
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.85
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.8
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.8
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.8
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.78
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.73
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.65
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.65
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.61
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.59
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.58
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.57
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.57
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.47
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.32
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.96  E-value=2.3e-27  Score=195.73  Aligned_cols=222  Identities=30%  Similarity=0.556  Sum_probs=157.3

Q ss_pred             Cccccc--CCCchHHhhhhcccCCCchHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCccccHHHHHHHHHHHHHH
Q 025543            2 GKGLIP--ADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIG   79 (251)
Q Consensus         2 g~gi~~--~~g~~wk~~Rr~~~~~f~~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~vd~~~~~~~~t~dvi~   79 (251)
                      |.|+++  .+|++|+++||++.+.|+...++.+.+.+.++++.+++.+.+. .       ++.++|+.+++.++++|+++
T Consensus        81 g~~~~~~~~~g~~wk~~Rk~l~~~fs~~~l~~~~~~i~~~~~~li~~l~~~-~-------~~~~idl~~~~~~~~~~~i~  152 (453)
T d2ij2a1          81 GDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERL-N-------ADEHIEVPEDMTRLTLDTIG  152 (453)
T ss_dssp             TTSGGGSCTTSHHHHHHHHHHGGGGSTTTHHHHHHHHHHHHHHHHHHHHTC-C-------TTCCEEHHHHHHHHHHHHHH
T ss_pred             CCcEEecCCChHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHhhhc-C-------CCCccchHHHHHHHhhhcch
Confidence            667765  4799999999999999999999999999999999999887542 1       12389999999999999999


Q ss_pred             hhhhccccCCCCCC--ChhHHHHHHHHHHhhhhhcccccccchhhhhhhcchhhhhHHHHHHHHHHHHHHHHHHHHHhhh
Q 025543           80 LGVFNYDFGSVTKE--SPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQE  157 (251)
Q Consensus        80 ~~~fG~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (251)
                      .++||.+++....+  .+.+..+...+..........     .|+...+....+.+.+..+.++.++...++++.+..  
T Consensus       153 ~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~--  225 (453)
T d2ij2a1         153 LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRA-----NPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASG--  225 (453)
T ss_dssp             HHHHSCCCCGGGCSSCCHHHHHHHHHHHHHHHTC--------CTTSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--
T ss_pred             hcccccccchhhhccchHHHHhhhhccchhhhhhhhc-----ccccccchhhHHHHHHHHHHHHHHHHHHHhhhcccc--
Confidence            99999988654332  334444443333221111011     111111111122333344445555544444332110  


Q ss_pred             hhHHHhhhhccccccchhHHHHHHHhc----CCCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhcCchHHHHHHHHH
Q 025543          158 TDVEKLQSRDYSNLKDASLLRFLVDMR----GADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEV  233 (251)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~l~~~~----~~~~~~~~i~~~~~~~~~AG~dTta~~l~~~~~~L~~~P~vq~kl~~Ei  233 (251)
                                   ....++++.+++..    +..++++++.+++.++++||+|||+++++|++++|++||++|+++++|+
T Consensus       226 -------------~~~~d~l~~ll~~~~~~~~~~ls~~ei~~~~~~~l~ag~~tta~~l~~~l~~L~~~p~~~~~~~~e~  292 (453)
T d2ij2a1         226 -------------EQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEA  292 (453)
T ss_dssp             -------------CCCSSHHHHHHHCCCTTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             -------------ccccchhhhhhhhcccccCcchhhhHHHhhhccccccccccchhhhhcchhhhhcccccchhhhhhh
Confidence                         01235777776532    3468999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCCCCChhhhccCC
Q 025543          234 DSVLGQKKPTFESLKKLE  251 (251)
Q Consensus       234 ~~v~~~~~~~~~dl~~Lp  251 (251)
                      +++.+...++++|+.+||
T Consensus       293 ~~~~~~~~~~~~~l~~~p  310 (453)
T d2ij2a1         293 ARVLVDPVPSYKQVKQLK  310 (453)
T ss_dssp             HHHCCSSSCCHHHHHTCH
T ss_pred             hhhhccccCChhhhhcCC
Confidence            999988788999999886
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure