Citrus Sinensis ID: 025543

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
ccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHccc
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLE*****GGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRN********************LKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 97B2, chloroplastic probableO48921
Cytochrome P450 97B3, chloroplastic Heme-containing cytochrome P450 probably involved in the biosynthesis of xanthophylls. Hydroxylates beta-rings of alpha-carotene. May also have activity on beta-rings of beta-carotene.probableO23365

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IJ2, chain A
Confidence level:very confident
Coverage over the Query: 2-154,165-251
View the alignment between query and template
View the model in PyMOL
Template: 3QI8, chain B
Confidence level:confident
Coverage over the Query: 12-167,185-251
View the alignment between query and template
View the model in PyMOL