Citrus Sinensis ID: 025550


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MLLTKPIVLFTVILSGTIIFILFFWPSSSYSHEQNPMARNFILWLHGLGDSGPANEPIKTLFTSPEFKLTKWSFPSAPNNPVTCNYGAVMPSWFDIHEIPVTASSPKDESSLLKAVRNVHAMIDKEVAAGIDPNNVFVCGFSQGGALTLASVLLYPRKLGGGAIFSGWVPFNASLIDQFTSDAKKTPILWSHGMADRTVLFEAGQAGPPFLEQAGISCEFKAYPGLGHSISNEELRNLESWIKTRMSCSSS
ccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEcccccccccHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHcccccCEEEEEccccccccccHHHcccccccccEEEEcccccccccHHHHHHcHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHcccccc
***TKPIVLFTVILSGTIIFILFFWPSSSYSHEQNPMARNFILWLHGLGDSGPANEPIKTLFTSPEFKLTKWSFPSAPNNPVTCNYGAVMPSWFDIHEIPVTASSPKDESSLLKAVRNVHAMIDKEVAAGIDPNNVFVCGFSQGGALTLASVLLYPRKLGGGAIFSGWVPFNASLIDQFTSDAKKTPILWSHGMADRTVLFEAGQAGPPFLEQAGISCEFKAYPGLGHSISNEELRNLESWIK*RMS****
xxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLTKPIVLFTVILSGTIIFILFFWPSSSYSHEQNPMARNFILWLHGLGDSGPANEPIKTLFTSPEFKLTKWSFPSAPNNPVTCNYGAVMPSWFDIHEIPVTASSPKDESSLLKAVRNVHAMIDKEVAAGIDPNNVFVCGFSQGGALTLASVLLYPRKLGGGAIFSGWVPFNASLIDQFTSDAKKTPILWSHGMADRTVLFEAGQAGPPFLEQAGISCEFKAYPGLGHSISNEELRNLESWIKTRMSCSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates.probableQ750X7
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates.probableQ4I8Q4
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates.probableQ6CGL4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U0V, chain A
Confidence level:very confident
Coverage over the Query: 34-247
View the alignment between query and template
View the model in PyMOL
Template: 3HXK, chain A
Confidence level:confident
Coverage over the Query: 10-93,106-248
View the alignment between query and template
View the model in PyMOL