Citrus Sinensis ID: 025575
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 250 | 2.2.26 [Sep-21-2011] | |||||||
| P40691 | 307 | Auxin-induced protein PCN | N/A | no | 0.912 | 0.742 | 0.811 | 1e-109 | |
| A2XRZ0 | 351 | Probable aldo-keto reduct | N/A | no | 0.904 | 0.643 | 0.801 | 1e-107 | |
| Q7XT99 | 351 | Probable aldo-keto reduct | yes | no | 0.904 | 0.643 | 0.801 | 1e-107 | |
| Q93ZN2 | 345 | Probable aldo-keto reduct | yes | no | 0.912 | 0.660 | 0.790 | 1e-105 | |
| P49249 | 306 | IN2-2 protein OS=Zea mays | N/A | no | 0.908 | 0.741 | 0.780 | 1e-105 | |
| O22707 | 345 | Probable aldo-keto reduct | no | no | 0.912 | 0.660 | 0.768 | 1e-103 | |
| Q9ASZ9 | 345 | Probable aldo-keto reduct | no | no | 0.912 | 0.660 | 0.751 | 1e-101 | |
| Q84M96 | 346 | Probable aldo-keto reduct | no | no | 0.912 | 0.658 | 0.739 | 1e-100 | |
| Q9C5B9 | 344 | Probable aldo-keto reduct | no | no | 0.916 | 0.665 | 0.765 | 1e-100 | |
| Q0JE32 | 350 | Probable aldo-keto reduct | no | no | 0.9 | 0.642 | 0.764 | 4e-98 |
| >sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 393 bits (1010), Expect = e-109, Method: Compositional matrix adjust.
Identities = 190/234 (81%), Positives = 205/234 (87%), Gaps = 6/234 (2%)
Query: 5 VKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPY 64
V RIKLGSQGLEVSAQGLGCM MS YGPP+PEPDMI LIHHAINSGITLLDTSD+YGP+
Sbjct: 8 VPRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIQLIHHAINSGITLLDTSDVYGPH 67
Query: 65 TNEILVGKALKGGMRERVELATKFGISFADGGK------IRGDPAYVRACCEASLKRLDI 118
TNEIL+GKALKGG RERV LATKFGI D K + GDPAYVRA CEASLKRLDI
Sbjct: 68 TNEILLGKALKGGTRERVVLATKFGIVLGDEKKAEGKRAVHGDPAYVRAACEASLKRLDI 127
Query: 119 DCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQL 178
DCIDLYYQHRVDT++PIE+T+GELKKLVEEGK+KYIGLSEA A+TIRRAHAVHPITAVQL
Sbjct: 128 DCIDLYYQHRVDTRVPIEITVGELKKLVEEGKLKYIGLSEASASTIRRAHAVHPITAVQL 187
Query: 179 EWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKVF 232
EWSLWSRDVE EI+PTCRELGIGIVAY PLG+GFLSSGPKL+E S D+RK
Sbjct: 188 EWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMSNEDYRKYL 241
|
Nicotiana tabacum (taxid: 4097) |
| >sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C5B9|AKR1_ARATH Probable aldo-keto reductase 1 OS=Arabidopsis thaliana GN=At1g10810 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0JE32|AKR1_ORYSJ Probable aldo-keto reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0337500 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 250 | ||||||
| 118487572 | 345 | unknown [Populus trichocarpa] | 0.92 | 0.666 | 0.828 | 1e-111 | |
| 224131488 | 343 | predicted protein [Populus trichocarpa] | 0.916 | 0.667 | 0.831 | 1e-110 | |
| 449468806 | 342 | PREDICTED: probable aldo-keto reductase | 0.92 | 0.672 | 0.835 | 1e-110 | |
| 147767361 | 341 | hypothetical protein VITISV_040294 [Viti | 0.912 | 0.668 | 0.829 | 1e-110 | |
| 225433674 | 341 | PREDICTED: auxin-induced protein PCNT115 | 0.912 | 0.668 | 0.825 | 1e-109 | |
| 449484655 | 342 | PREDICTED: probable aldo-keto reductase | 0.92 | 0.672 | 0.835 | 1e-109 | |
| 62526573 | 344 | aldo/keto reductase AKR [Manihot esculen | 0.92 | 0.668 | 0.827 | 1e-109 | |
| 224069573 | 343 | predicted protein [Populus trichocarpa] | 0.904 | 0.658 | 0.828 | 1e-109 | |
| 255591425 | 256 | aldo/keto reductase, putative [Ricinus c | 0.904 | 0.882 | 0.828 | 1e-109 | |
| 225433670 | 341 | PREDICTED: auxin-induced protein PCNT115 | 0.916 | 0.671 | 0.817 | 1e-108 |
| >gi|118487572|gb|ABK95612.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 405 bits (1042), Expect = e-111, Method: Compositional matrix adjust.
Identities = 193/233 (82%), Positives = 215/233 (92%), Gaps = 3/233 (1%)
Query: 1 MAGTVKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDI 60
MA VKRIKLGSQGLEVSAQGLGCM MS YGPP+PE DM++LIHHAIN+G+TLLDTSD+
Sbjct: 1 MAAAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMVSLIHHAINTGVTLLDTSDM 60
Query: 61 YGPYTNEILVGKALKGG--MRERVELATKFGISFADGGK-IRGDPAYVRACCEASLKRLD 117
YGP+TNEIL+GKALK G +RE+VELATKFGI+F DG + IRGDPAYVRA CEASLKRL
Sbjct: 61 YGPHTNEILLGKALKAGSGLREKVELATKFGINFQDGKREIRGDPAYVRAACEASLKRLQ 120
Query: 118 IDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQ 177
+DC+DLYYQHR+DTK+PIEVT+GELKKLVEEGKIKYIGLSEA A+TIRRAHAVHP+TAVQ
Sbjct: 121 LDCVDLYYQHRIDTKVPIEVTMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQ 180
Query: 178 LEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRK 230
LEWSLWSRDVE EIVPTCRELGIGIVAY PLG+GFLSSGPKLVESF++ DFRK
Sbjct: 181 LEWSLWSRDVEEEIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESFTEGDFRK 233
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224131488|ref|XP_002321097.1| predicted protein [Populus trichocarpa] gi|222861870|gb|EEE99412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449468806|ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147767361|emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225433674|ref|XP_002266027.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449484655|ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] | Back alignment and taxonomy information |
|---|
| >gi|224069573|ref|XP_002303002.1| predicted protein [Populus trichocarpa] gi|222844728|gb|EEE82275.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255591425|ref|XP_002535506.1| aldo/keto reductase, putative [Ricinus communis] gi|223522847|gb|EEF26877.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225433670|ref|XP_002265927.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 250 | ||||||
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.904 | 0.655 | 0.797 | 4.1e-97 | |
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.904 | 0.655 | 0.775 | 1.4e-94 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.912 | 0.662 | 0.766 | 3.9e-92 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.904 | 0.653 | 0.745 | 8.1e-92 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.836 | 0.633 | 0.763 | 4.3e-86 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.888 | 0.664 | 0.517 | 3.7e-55 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.88 | 0.672 | 0.530 | 3.4e-54 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.876 | 0.644 | 0.454 | 3.9e-44 | |
| ASPGD|ASPL0000051701 | 339 | AN10217 [Emericella nidulans ( | 0.868 | 0.640 | 0.422 | 7.5e-41 | |
| ASPGD|ASPL0000072041 | 351 | AN8733 [Emericella nidulans (t | 0.88 | 0.626 | 0.408 | 1.6e-40 |
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 965 (344.8 bits), Expect = 4.1e-97, P = 4.1e-97
Identities = 181/227 (79%), Positives = 207/227 (91%)
Query: 5 VKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPY 64
V+R+KLGSQGLEVSAQGLGCM +S YG P+PE + IALIHHAI+SG+TLLDTSDIYGP
Sbjct: 7 VRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPE 66
Query: 65 TNEILVGKALKGGMRERVELATKFGISFADGGK-IRGDPAYVRACCEASLKRLDIDCIDL 123
TNE+L+GKALK G+RE+VELATKFGIS+A+G + +RGDP YVRA CEASLKRLDI CIDL
Sbjct: 67 TNEVLLGKALKDGVREKVELATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDL 126
Query: 124 YYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLW 183
YYQHRVDT++PIE+T+GELKKLVEEGKIKYIGLSEA A+TIRRAHAVHPITAVQ+EWSLW
Sbjct: 127 YYQHRVDTRVPIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLW 186
Query: 184 SRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRK 230
+RDVE EI+PTCRELGIGIVAY PLG+GF +SGPKLVE+ K DFRK
Sbjct: 187 TRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRK 233
|
|
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P40691 | A115_TOBAC | No assigned EC number | 0.8119 | 0.912 | 0.7426 | N/A | no |
| P49249 | IN22_MAIZE | No assigned EC number | 0.7807 | 0.908 | 0.7418 | N/A | no |
| Q7XT99 | AKR2_ORYSJ | 1, ., 1, ., 1, ., - | 0.8017 | 0.904 | 0.6438 | yes | no |
| B8ASB2 | AKR1_ORYSI | 1, ., 1, ., 1, ., - | 0.7641 | 0.9 | 0.6428 | N/A | no |
| Q93ZN2 | ALKR4_ARATH | 1, ., 1, ., 1, ., - | 0.7903 | 0.912 | 0.6608 | yes | no |
| A2XRZ0 | AKR2_ORYSI | 1, ., 1, ., 1, ., - | 0.8017 | 0.904 | 0.6438 | N/A | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.1.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.XIV.3153.1 | SubName- Full=Putative uncharacterized protein; (343 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 250 | |||
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 6e-81 | |
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 5e-77 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 6e-65 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 5e-32 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 5e-25 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 1e-21 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 8e-21 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 4e-20 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 3e-19 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 2e-16 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 1e-15 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 8e-08 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 9e-06 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
Score = 244 bits (624), Expect = 6e-81
Identities = 89/229 (38%), Positives = 122/229 (53%), Gaps = 9/229 (3%)
Query: 7 RIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTN 66
LG GL+VS GLG + G E + A + A+++GI +DT+D+YG +
Sbjct: 1 YRTLGKTGLKVSRLGLGTWQLG---GGYVDEEEAAAAVRAALDAGINFIDTADVYGDGES 57
Query: 67 EILVGKALKG-GMRERVELATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDCIDLYY 125
E L+G+ALK G RE V +ATK G DG P ++R E SLKRL D IDLY
Sbjct: 58 EELLGEALKERGPREEVFIATKVGPRPGDG--RDLSPEHIRRAVEESLKRLGTDYIDLYL 115
Query: 126 QHRVDTKIP-IEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAV--HPITAVQLEWSL 182
H D P IE T+ L++LV+EGKI+ IG+S A + A A P Q+E++L
Sbjct: 116 LHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVEYNL 175
Query: 183 WSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKV 231
R E E++P CRE GIG++AY PL G L+ + D +
Sbjct: 176 LDRQAEEELLPYCREHGIGVIAYSPLAGGLLTGKYLPGAPPPEGDLLEA 224
|
AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 250 | |||
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 100.0 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 98.25 | |
| cd03319 | 316 | L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat | 93.88 | |
| COG0635 | 416 | HemN Coproporphyrinogen III oxidase and related Fe | 92.44 | |
| PRK07945 | 335 | hypothetical protein; Provisional | 89.61 | |
| cd03316 | 357 | MR_like Mandelate racemase (MR)-like subfamily of | 89.49 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 88.51 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 85.96 | |
| cd03174 | 265 | DRE_TIM_metallolyase DRE-TIM metallolyase superfam | 83.91 | |
| cd03315 | 265 | MLE_like Muconate lactonizing enzyme (MLE) like su | 82.8 | |
| PRK06294 | 370 | coproporphyrinogen III oxidase; Provisional | 82.29 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 82.17 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 82.06 | |
| PRK07379 | 400 | coproporphyrinogen III oxidase; Provisional | 82.04 | |
| COG0135 | 208 | TrpF Phosphoribosylanthranilate isomerase [Amino a | 82.04 | |
| COG1140 | 513 | NarY Nitrate reductase beta subunit [Energy produc | 82.04 | |
| cd00308 | 229 | enolase_like Enolase-superfamily, characterized by | 81.82 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 81.03 | |
| PRK08392 | 215 | hypothetical protein; Provisional | 81.02 |
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9e-55 Score=379.52 Aligned_cols=215 Identities=44% Similarity=0.691 Sum_probs=196.0
Q ss_pred CceeecCCCCcccCceeecccccCCCCCCCCChHHHHHHHHHHHHcCCCeEeCcCCcCCCChHHHHHHHhcCCC-CCCEE
Q 025575 5 VKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTNEILVGKALKGGM-RERVE 83 (250)
Q Consensus 5 m~~~~lg~~g~~vs~lglG~~~~g~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~lg~~l~~~~-R~~~~ 83 (250)
|++|+||++|++||+||||||.+|+.+ ...+.+++.++|++|+++|||+||||+.||.|.||+++|++|++.. |++++
T Consensus 1 m~~r~lG~~gl~vs~lglG~~~~g~~~-~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vv 79 (316)
T COG0667 1 MKYRRLGRSGLKVSPLGLGTMTLGGDT-DDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVV 79 (316)
T ss_pred CCceecCCCCceecceeeeccccCCCC-CchhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEE
Confidence 789999999999999999999998642 2224556778999999999999999999999999999999999865 89999
Q ss_pred EEeeeCcccCC-C-C-CCCCCHHHHHHHHHHHHHHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCcceEecCccc
Q 025575 84 LATKFGISFAD-G-G-KIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEAC 160 (250)
Q Consensus 84 i~tK~~~~~~~-~-~-~~~~~~~~i~~~l~~sL~~L~~d~iDl~~lh~p~~~~~~~~~~~~l~~l~~~G~ir~iGvSn~~ 160 (250)
|+||++..+.+ . . ..+.++++|+++++.||+||||||||||++||||+..+.++++++|.+|+++|+||+||+||++
T Consensus 80 IaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~~ 159 (316)
T COG0667 80 IATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYS 159 (316)
T ss_pred EEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCCC
Confidence 99999876542 2 1 2567999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhc-CCceEEeeecCcCCcCchhhhHHHHHHhCCeEEEeccCccCcCCCCCCCCC
Q 025575 161 AATIRRAHAV-HPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVE 221 (250)
Q Consensus 161 ~~~l~~~~~~-~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~via~spl~~G~L~~g~~~~~ 221 (250)
.+++.++++. .+++++|.+||++++..+.+++++|+++||++++||||++|+|+ ||+.+.
T Consensus 160 ~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G~Lt-gk~~~~ 220 (316)
T COG0667 160 AEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLT-GKYLPG 220 (316)
T ss_pred HHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEEecCccccccC-CCcCCC
Confidence 9999999999 59999999999999877777999999999999999999999999 996654
|
|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides | Back alignment and domain information |
|---|
| >COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07945 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily | Back alignment and domain information |
|---|
| >cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK06294 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07379 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >PRK08392 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 250 | ||||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-72 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-72 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 7e-72 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-69 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 7e-26 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 6e-24 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 6e-24 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 6e-23 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 1e-17 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 3e-15 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 4e-15 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 2e-14 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 2e-14 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 4e-14 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 5e-14 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 5e-14 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 5e-14 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 5e-14 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 6e-14 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 7e-14 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 7e-14 | ||
| 1gve_A | 327 | Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live | 3e-13 | ||
| 2clp_A | 347 | Crystal Structure Of Human Aflatoxin B1 Aldehyde Re | 2e-12 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 3e-12 | ||
| 1ur3_M | 319 | Crystal Structure Of The Apo Form Of The E.Coli Ydh | 4e-11 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 5e-11 | ||
| 1og6_A | 298 | Ydhf, An Aldo-keto Reductase From E.coli Complexed | 1e-10 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 3e-09 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 3e-08 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 1e-07 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 4e-07 | ||
| 4exa_A | 292 | Crystal Structure Of The Pa4992, The Putative Aldo- | 5e-07 | ||
| 1sm9_A | 322 | Crystal Structure Of An Engineered K274rn276d Doubl | 6e-07 | ||
| 1jez_A | 322 | The Structure Of Xylose Reductase, A Dimeric Aldo-K | 6e-07 | ||
| 1ye4_A | 322 | Crystal Structure Of The Lys-274 To Arg Mutant Of C | 6e-07 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 1e-06 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 1e-06 | ||
| 1r38_A | 322 | Crystal Structure Of H114a Mutant Of Candida Tenuis | 1e-06 | ||
| 1z9a_A | 321 | Crystal Structure Of The Asn-309 To Asp Mutant Of C | 3e-06 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 6e-06 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 1e-05 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 1e-05 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 1e-05 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 2e-05 | ||
| 3b3d_A | 314 | B.Subtilis Ytbe Length = 314 | 2e-05 | ||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 3e-05 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 4e-05 | ||
| 1vbj_A | 281 | The Crystal Structure Of Prostaglandin F Synthase F | 5e-05 | ||
| 2alr_A | 324 | Aldehyde Reductase Length = 324 | 5e-05 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 1e-04 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 1e-04 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 1e-04 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 1e-04 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 2e-04 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 4e-04 |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
|
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 | Back alignment and structure |
| >pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
| >pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 | Back alignment and structure |
| >pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 | Back alignment and structure |
| >pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 | Back alignment and structure |
| >pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 | Back alignment and structure |
| >pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 | Back alignment and structure |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
| >pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 | Back alignment and structure |
| >pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
Score = 395 bits (1017), Expect = e-140
Identities = 67/233 (28%), Positives = 113/233 (48%), Gaps = 7/233 (3%)
Query: 4 TVKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGP 63
I++ +S LG A+ + + + IH A++ GI L+DT+ +YG
Sbjct: 18 ASDTIRIPGIDTPLSRVALGTWAIGGWMWGGPDDDNGVRTIHAALDEGINLIDTAPVYGF 77
Query: 64 YTNEILVGKALKGGMRERVELATKFGISFADGGK------IRGDPAYVRACCEASLKRLD 117
+E +VG+AL + +ATK G+ + + PA +R E SL+RL
Sbjct: 78 GHSEEIVGRALAE-KPNKAHVATKLGLHWVGEDEKNMKVFRDSRPARIRKEVEDSLRRLR 136
Query: 118 IDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQ 177
++ IDL H D K PI+ + EL+KL ++GKI+ +G+S + V P+ +Q
Sbjct: 137 VETIDLEQIHWPDDKTPIDESARELQKLHQDGKIRALGVSNFSPEQMDIFREVAPLATIQ 196
Query: 178 LEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRK 230
+L+ R +E +I+P + ++AYG L +G L+ +F K D R
Sbjct: 197 PPLNLFERTIEKDILPYAEKHNAVVLAYGALCRGLLTGKMNRDTTFPKDDLRS 249
|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 250 | |||
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.96 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 92.17 | |
| 2rdx_A | 379 | Mandelate racemase/muconate lactonizing enzyme, P; | 91.85 | |
| 2nql_A | 388 | AGR_PAT_674P, isomerase/lactonizing enzyme; enolas | 91.71 | |
| 2ovl_A | 371 | Putative racemase; structural genomics, PSI-2, pro | 91.36 | |
| 2poz_A | 392 | Putative dehydratase; octamer, structural genomics | 91.2 | |
| 1mdl_A | 359 | Mandelate racemase; isomerase, mandelate pathway, | 90.94 | |
| 2zad_A | 345 | Muconate cycloisomerase; muconate lactonizing enzy | 90.92 | |
| 1r0m_A | 375 | N-acylamino acid racemase; isomerase; 1.30A {Deino | 90.42 | |
| 2o56_A | 407 | Putative mandelate racemase; dehydratase, structur | 90.23 | |
| 1nu5_A | 370 | Chloromuconate cycloisomerase; enzyme, dehalogenat | 89.46 | |
| 3i4k_A | 383 | Muconate lactonizing enzyme; structural genomics, | 89.06 | |
| 3jva_A | 354 | Dipeptide epimerase; enolase superfamily, isomeras | 88.75 | |
| 3fv9_G | 386 | Mandelate racemase/muconate lactonizing enzyme; st | 88.68 | |
| 2qde_A | 397 | Mandelate racemase/muconate lactonizing enzyme FA | 88.65 | |
| 2og9_A | 393 | Mandelate racemase/muconate lactonizing enzyme; NY | 88.51 | |
| 3gd6_A | 391 | Muconate cycloisomerase; structural genomics, NYSG | 88.39 | |
| 3dg3_A | 367 | Muconate cycloisomerase; muconate lactonizing enzy | 88.13 | |
| 3eez_A | 378 | Putative mandelate racemase/muconate lactonizing e | 87.86 | |
| 4h1z_A | 412 | Enolase Q92ZS5; dehydratase, magnesium binding sit | 87.58 | |
| 3i6e_A | 385 | Muconate cycloisomerase I; structural genomics, NY | 87.44 | |
| 2qgy_A | 391 | Enolase from the environmental genome shotgun sequ | 87.4 | |
| 2ox4_A | 403 | Putative mandelate racemase; enolase, dehydratase, | 87.22 | |
| 2ps2_A | 371 | Putative mandelate racemase/muconate lactonizing e | 87.0 | |
| 1tkk_A | 366 | Similar to chloromuconate cycloisomerase; epimeras | 86.74 | |
| 2zc8_A | 369 | N-acylamino acid racemase; octamer, TIM beta/alpha | 86.69 | |
| 2pp0_A | 398 | L-talarate/galactarate dehydratase; enolase superf | 86.65 | |
| 2qdd_A | 378 | Mandelate racemase/muconate lactonizing enzyme; en | 86.41 | |
| 2p8b_A | 369 | Mandelate racemase/muconate lactonizing enzyme fam | 86.31 | |
| 3mwc_A | 400 | Mandelate racemase/muconate lactonizing protein; e | 86.3 | |
| 2gl5_A | 410 | Putative dehydratase protein; structural genomics, | 86.02 | |
| 3q45_A | 368 | Mandelate racemase/muconate lactonizing enzyme FA | 85.8 | |
| 3bjs_A | 428 | Mandelate racemase/muconate lactonizing enzyme; en | 85.75 | |
| 4e8g_A | 391 | Enolase, mandelate racemase/muconate lactonizing e | 85.5 | |
| 2hzg_A | 401 | Mandelate racemase/muconate lactonizing enzyme/EN | 85.14 | |
| 1wuf_A | 393 | Hypothetical protein LIN2664; structural genomics, | 84.94 | |
| 3s5s_A | 389 | Mandelate racemase/muconate lactonizing enzyme FA | 84.43 | |
| 3tj4_A | 372 | Mandelate racemase; enolase, dehydratase, enzyme f | 84.12 | |
| 2oz8_A | 389 | MLL7089 protein; structural genomics, unknown func | 83.52 | |
| 1rvk_A | 382 | Isomerase/lactonizing enzyme; enolase superfamily, | 83.29 | |
| 4dwd_A | 393 | Mandelate racemase/muconate lactonizing enzyme, C | 82.52 | |
| 3r0u_A | 379 | Enzyme of enolase superfamily; structural genomics | 82.43 | |
| 2qq6_A | 410 | Mandelate racemase/muconate lactonizing enzyme- li | 82.24 | |
| 1sjd_A | 368 | N-acylamino acid racemase; lyase, isomerase; HET: | 82.19 | |
| 3qld_A | 388 | Mandelate racemase/muconate lactonizing protein; s | 82.13 | |
| 3ik4_A | 365 | Mandelate racemase/muconate lactonizing protein; s | 81.69 | |
| 4dye_A | 398 | Isomerase; enolase family protein, EFI, enzym func | 81.12 | |
| 3ozy_A | 389 | Putative mandelate racemase; beta-alpha barrel, en | 80.27 | |
| 2hxt_A | 441 | L-fuconate dehydratase; enolase superfamily, D-ery | 80.09 | |
| 1tzz_A | 392 | Hypothetical protein L1841; structural genomics, m | 80.06 |
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-57 Score=398.72 Aligned_cols=231 Identities=31% Similarity=0.511 Sum_probs=207.2
Q ss_pred CceeecCCCCcccCceeecccccCCC-CCCCCChHHHHHHHHHHHHcCCCeEeCcCCcCCCChHHHHHHHhcCCCCCCEE
Q 025575 5 VKRIKLGSQGLEVSAQGLGCMAMSCL-YGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTNEILVGKALKGGMRERVE 83 (250)
Q Consensus 5 m~~~~lg~~g~~vs~lglG~~~~g~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~lg~~l~~~~R~~~~ 83 (250)
|++++||++|++||+||||||++|.. |+.. +.+++.++|+.|++.|||+||||+.||+|.||+.+|++|+. +|+++|
T Consensus 19 M~~~~lg~tg~~vs~lglGt~~~g~~~~g~~-~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~sE~~lG~al~~-~R~~v~ 96 (348)
T 3n2t_A 19 SDTIRIPGIDTPLSRVALGTWAIGGWMWGGP-DDDNGVRTIHAALDEGINLIDTAPVYGFGHSEEIVGRALAE-KPNKAH 96 (348)
T ss_dssp TSEECCTTCSSCEESEEEECTTSSCSSSCST-THHHHHHHHHHHHHTTCCEEECCTTGGGGHHHHHHHHHHHH-SCCCCE
T ss_pred ceeeecCCCCCccCCEeEeCccccCCCCCCC-CHHHHHHHHHHHHHcCCCEEEChhhcCCChHHHHHHHHHhh-CCCeEE
Confidence 89999999999999999999999853 5443 78889999999999999999999999999999999999998 899999
Q ss_pred EEeeeCccc--CCC----CCCCCCHHHHHHHHHHHHHHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCcceEecC
Q 025575 84 LATKFGISF--ADG----GKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLS 157 (250)
Q Consensus 84 i~tK~~~~~--~~~----~~~~~~~~~i~~~l~~sL~~L~~d~iDl~~lh~p~~~~~~~~~~~~l~~l~~~G~ir~iGvS 157 (250)
|+||++..+ ..+ ...+.+++.+++++++||++||+||||+|++|||++..+++++|++|++|+++||||+||||
T Consensus 97 I~TK~g~~~~~~~~~~~~~~~~~~~~~i~~~~e~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvS 176 (348)
T 3n2t_A 97 VATKLGLHWVGEDEKNMKVFRDSRPARIRKEVEDSLRRLRVETIDLEQIHWPDDKTPIDESARELQKLHQDGKIRALGVS 176 (348)
T ss_dssp EEEEECEEEESSSTTTCEEEECCCHHHHHHHHHHHHHHHTCSSEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEE
T ss_pred EEEeecCCCcCCCcccccccCCCCHHHHHHHHHHHHHHhCCCcEEEEEecCCCCCCCHHHHHHHHHHHHHhCcceEEecC
Confidence 999997543 111 11246899999999999999999999999999999999999999999999999999999999
Q ss_pred cccHHHHHHHhhcCCceEEeeecCcCCcCchhhhHHHHHHhCCeEEEeccCccCcCCCCC-CCCCCCCCCccccccccCC
Q 025575 158 EACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGP-KLVESFSKYDFRKVFCWNL 236 (250)
Q Consensus 158 n~~~~~l~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~via~spl~~G~L~~g~-~~~~~~~~~~~~~~~~~~~ 236 (250)
||++++++++++..+|+++|++||++.+..+.+++++|+++||++++|+||++|+|+ |+ .....+++++.|. ..+
T Consensus 177 n~~~~~l~~~~~~~~~~~~Q~~~nl~~~~~e~~l~~~~~~~gi~v~a~spL~~G~Lt-g~~~~~~~~~~~~~r~---~~~ 252 (348)
T 3n2t_A 177 NFSPEQMDIFREVAPLATIQPPLNLFERTIEKDILPYAEKHNAVVLAYGALCRGLLT-GKMNRDTTFPKDDLRS---NDP 252 (348)
T ss_dssp SCCHHHHHHHHHHSCCCEEECBCBTTBCGGGGTHHHHHHHHTCEEEEBCTTGGGGGG-TCCCTTCCCCTTSGGG---GCG
T ss_pred CCCHHHHHHHHHhCCccEEEeeecCccCchHHHHHHHHHHcCCeEEEeecccCcccc-CCccCCCCCCCcchhh---ccc
Confidence 999999999999999999999999999987789999999999999999999999999 88 4445667777786 566
Q ss_pred CCCCC
Q 025575 237 SFSSR 241 (250)
Q Consensus 237 ~~~~~ 241 (250)
.|.+.
T Consensus 253 ~~~~~ 257 (348)
T 3n2t_A 253 KFQKP 257 (348)
T ss_dssp GGSTT
T ss_pred ccchh
Confidence 66554
|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} | Back alignment and structure |
|---|
| >2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A | Back alignment and structure |
|---|
| >2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A | Back alignment and structure |
|---|
| >2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A | Back alignment and structure |
|---|
| >2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A | Back alignment and structure |
|---|
| >1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A | Back alignment and structure |
|---|
| >2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* | Back alignment and structure |
|---|
| >3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A | Back alignment and structure |
|---|
| >2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} | Back alignment and structure |
|---|
| >2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* | Back alignment and structure |
|---|
| >3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* | Back alignment and structure |
|---|
| >3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* | Back alignment and structure |
|---|
| >3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A | Back alignment and structure |
|---|
| >3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A | Back alignment and structure |
|---|
| >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} | Back alignment and structure |
|---|
| >2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A | Back alignment and structure |
|---|
| >2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* | Back alignment and structure |
|---|
| >2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B | Back alignment and structure |
|---|
| >2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* | Back alignment and structure |
|---|
| >3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} | Back alignment and structure |
|---|
| >2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* | Back alignment and structure |
|---|
| >3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A | Back alignment and structure |
|---|
| >3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} | Back alignment and structure |
|---|
| >2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} | Back alignment and structure |
|---|
| >3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* | Back alignment and structure |
|---|
| >2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* | Back alignment and structure |
|---|
| >3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* | Back alignment and structure |
|---|
| >2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} | Back alignment and structure |
|---|
| >1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* | Back alignment and structure |
|---|
| >3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} | Back alignment and structure |
|---|
| >3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} | Back alignment and structure |
|---|
| >4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A | Back alignment and structure |
|---|
| >3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* | Back alignment and structure |
|---|
| >2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A | Back alignment and structure |
|---|
| >1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 250 | ||||
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 9e-44 | |
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 2e-43 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 3e-34 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 1e-32 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 1e-31 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 4e-31 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 7e-31 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 1e-28 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-28 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 5e-27 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 2e-26 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 5e-26 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 5e-26 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 2e-24 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 7e-24 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 4e-20 |
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Tas protein species: Escherichia coli [TaxId: 562]
Score = 148 bits (375), Expect = 9e-44
Identities = 56/248 (22%), Positives = 89/248 (35%), Gaps = 40/248 (16%)
Query: 6 KRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYT 65
+ ++ LEVS GLG M G E D A + +A+ GI L+D +++Y
Sbjct: 2 QYHRIPHSSLEVSTLGLGTMTF----GEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPP 57
Query: 66 NEILVGKALKGGMRERVELATKFGISFADGGKIRGD-------------PAYVRACCEAS 112
G + ++ + A +R S
Sbjct: 58 RPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDS 117
Query: 113 LKRLDIDCIDLYYQHRVD-----------------TKIPIEVTIGELKKLVEEGKIKYIG 155
LKRL D +DLY H + + T+ L + GKI+YIG
Sbjct: 118 LKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIG 177
Query: 156 LSEACAATIRRA------HAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLG 209
+S A + R H + I +Q +SL +R E + + G+ ++AY LG
Sbjct: 178 VSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLG 237
Query: 210 QGFLSSGP 217
G L+
Sbjct: 238 FGTLTGKY 245
|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 250 | |||
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1nu5a1 | 243 | Chlormuconate cycloisomerase {Pseudomonas sp. p51 | 90.26 | |
| d1kcza1 | 253 | beta-Methylaspartase {Clostridium tetanomorphum [T | 90.08 | |
| d1r0ma1 | 243 | N-acylamino acid racemase {Deinococcus radiodurans | 89.97 | |
| d1sjda1 | 242 | N-acylamino acid racemase {Amycolatopsis sp. [TaxI | 89.42 | |
| d1kkoa1 | 251 | beta-Methylaspartase {Citrobacter amalonaticus [Ta | 88.52 | |
| d2chra1 | 244 | Chlormuconate cycloisomerase {Alcaligenes eutrophu | 87.24 | |
| d1muca1 | 242 | Muconate-lactonizing enzyme {Pseudomonas putida [T | 85.28 | |
| d1jpma1 | 234 | L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: | 84.88 | |
| d1jdfa1 | 309 | D-glucarate dehydratase {Escherichia coli [TaxId: | 83.06 | |
| d1wufa1 | 244 | N-acylamino acid racemase {Listeria innocua [TaxId | 82.29 | |
| d1olta_ | 441 | Oxygen-independent coproporphyrinogen III oxidase | 82.07 | |
| d1wuea1 | 241 | N-acylamino acid racemase {Enterococcus faecalis [ | 81.64 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=4.2e-51 Score=353.45 Aligned_cols=224 Identities=32% Similarity=0.478 Sum_probs=203.6
Q ss_pred ceeecCCCCcccCceeecccccCCC-CCCCCChHHHHHHHHHHHHcCCCeEeCcCCcCCCChHHHHHHHhcCCCCCCEEE
Q 025575 6 KRIKLGSQGLEVSAQGLGCMAMSCL-YGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTNEILVGKALKGGMRERVEL 84 (250)
Q Consensus 6 ~~~~lg~~g~~vs~lglG~~~~g~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~lg~~l~~~~R~~~~i 84 (250)
++|+||+||++||+||||||++|+. +....+++++.++|++|+++|||+||||+.||+|.+|+.+|++++..+|++++|
T Consensus 1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~sE~~lg~~l~~~~r~~~~i 80 (311)
T d1pyfa_ 1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVI 80 (311)
T ss_dssp CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEE
T ss_pred CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCccHHHHhhhhhcccccceec
Confidence 5899999999999999999999863 233457888999999999999999999999999999999999999889999999
Q ss_pred EeeeCcccCCC-CCCCCCHHHHHHHHHHHHHHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCcceEecCcccHHH
Q 025575 85 ATKFGISFADG-GKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAAT 163 (250)
Q Consensus 85 ~tK~~~~~~~~-~~~~~~~~~i~~~l~~sL~~L~~d~iDl~~lh~p~~~~~~~~~~~~l~~l~~~G~ir~iGvSn~~~~~ 163 (250)
+||++.....+ ...+.+++.+++++++||++|++||||++++|+|++..+.++++++|++|+++|+|++|||||++.+.
T Consensus 81 ~tK~~~~~~~~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~~~ 160 (311)
T d1pyfa_ 81 ATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQ 160 (311)
T ss_dssp EEEECEEEETTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHHH
T ss_pred ceeccCCCCCcccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcHHH
Confidence 99998654333 23467899999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhcCCceEEeeecCcCCcCchhhhHHHHHHhCCeEEEeccCccCcCCCCC-CCCCCCCCCcccc
Q 025575 164 IRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGP-KLVESFSKYDFRK 230 (250)
Q Consensus 164 l~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~via~spl~~G~L~~g~-~~~~~~~~~~~~~ 230 (250)
+.++.+..+++++|++||++.+....+++++|+++||++++|+||++|+|+ ++ .....++..+.+.
T Consensus 161 ~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~-~~~~~~~~~~~~~~~~ 227 (311)
T d1pyfa_ 161 LKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLA-GKYTEDTTFPEGDLRN 227 (311)
T ss_dssp HHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGG-TCCCTTCCCCTTCGGG
T ss_pred HHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCccC-CCcCcCCCCccccccc
Confidence 999999999999999999999987789999999999999999999999999 77 5555666666665
|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} | Back information, alignment and structure |
|---|
| >d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} | Back information, alignment and structure |
|---|
| >d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} | Back information, alignment and structure |
|---|
| >d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} | Back information, alignment and structure |
|---|
| >d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} | Back information, alignment and structure |
|---|
| >d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|