Citrus Sinensis ID: 025577

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MASNTLMSCGIATTAFPSVLSSSKSKFFTAVSLPAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVVSSKFFWILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVIIPRGIVP
cHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccccccccc
*AS************************************************GEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVVSSKFFWILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVIIPRGIV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNTLMSCGIATTAFPSVLSSSKSKFFTAVSLPAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVVSSKFFWILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVIIPRGIVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chlorophyll a-b binding protein 6, chloroplastic The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.confidentQ01667
Chlorophyll a-b binding protein 1B-21, chloroplastic The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.probableQ9SDM1
Chlorophyll a-b binding protein 6A, chloroplastic The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.probableP12360

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain 1
Confidence level:very confident
Coverage over the Query: 62-236
View the alignment between query and template
View the model in PyMOL