Citrus Sinensis ID: 025594


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MGDTSASTAADDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQMRISEEEGRLKKDEEEQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNKSYVQRPVKRG
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
*************LLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAA*****************************************ELKLKVREILTQ********************************************EQRVS***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDTSASTAADDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRxxxxxxxxxxxxxxxxxxxxxQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNKSYVQRPVKRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily C member 8 probableQ642C0
DnaJ homolog subfamily C member 8 probableO75937
DnaJ homolog subfamily C member 8 probableQ6NZB0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CTW, chain A
Confidence level:very confident
Coverage over the Query: 35-109
View the alignment between query and template
View the model in PyMOL
Template: 3AG7, chain A
Confidence level:confident
Coverage over the Query: 14-97
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 58-122,167-236
View the alignment between query and template
View the model in PyMOL