Citrus Sinensis ID: 025594

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MGDTSASTAADDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQMRISEEEGRLKKDEEEQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNKSYVQRPVKRG
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHHEcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccccccccccccccccccEEcccccc
mgdtsastaaddDLLLKSFFAEVSEVERDNEVLRILScfklnpfeylnlpfdatpddIKKQYRKLSllvhpdkckhpqaKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQMRISEEEGRLKKDEEEQKEMWKRKREHEEQWEGTREQRVSSWRDFMktgkkgkkgeirppklktedpnksyvqrpvkrg
mgdtsastaadddllLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAakgelrakrkkqlkkDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQmriseeegrlkkdeeeQKEMWkrkreheeqwegtreqrvsswrdfmktgkkgkkgeirppklktedpnksyvqrpvkrg
MGdtsastaadddlllKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYeqqyeqseefqqeLKLKVREILTQQEWRRRKMQMRISeeegrlkkdeeeQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNKSYVQRPVKRG
*************LLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKC********FGA***************YILTQV************************************************************************************************************************************************
**************************ERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAA*****************************************ELKLKVREILTQ********************************************EQRVS***************************************
*********ADDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGE***************KIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKM****************************************SSWRDFMKTGKKGKKGEIRPPKLKTE**************
**********DDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQMRIS***********E*KEMWKRK**HEEQWEGTREQRVSSWRDFMKTG*******IRPPKLK****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDTSASTAADDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRxxxxxxxxxxxxxxxxxxxxxQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNKSYVQRPVKRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
O75937253 DnaJ homolog subfamily C yes no 0.836 0.826 0.343 9e-22
Q642C0253 DnaJ homolog subfamily C yes no 0.836 0.826 0.343 4e-21
Q6NZB0253 DnaJ homolog subfamily C yes no 0.836 0.826 0.343 4e-21
O74746209 J domain-containing prote yes no 0.696 0.832 0.335 7e-19
Q9UXR9 387 Chaperone protein DnaJ OS N/A no 0.224 0.144 0.517 3e-08
Q921R4703 DnaJ homolog subfamily C no no 0.276 0.098 0.405 8e-08
Q6Y2X3702 DnaJ homolog subfamily C no no 0.276 0.098 0.405 9e-08
Q95J56699 DnaJ homolog subfamily C no no 0.276 0.098 0.405 1e-07
Q5XIX0703 DnaJ homolog subfamily C no no 0.276 0.098 0.405 1e-07
Q8TQR1 382 Chaperone protein DnaJ OS yes no 0.224 0.146 0.482 2e-07
>sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 Back     alignment and function desciption
 Score =  103 bits (258), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 140/239 (58%), Gaps = 30/239 (12%)

Query: 18  SFFAEVSEVERDNEVL-------RIL----SCFKLNPFEYLNLPFDATPDDIKKQYRKLS 66
           +F++EV ++E+ + VL       R+     S F LNPFE L +  + T ++IKK++R+LS
Sbjct: 22  TFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTDEEIKKRFRQLS 81

Query: 67  LLVHPDKCKHP--QAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELR---AKRKKQL 121
           +LVHPDK +    +A++AF A+ KA +LL D++++   L  + A K  +     +RKKQL
Sbjct: 82  ILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQL 141

Query: 122 KKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQMRISEEEGRL 181
           KK+      ++V+E       +  E F+Q +  +  ++  + E +R++ + +   E  R 
Sbjct: 142 KKEGKP---TIVEE-------DDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQ 191

Query: 182 KKDEEEQKEMWKRKREHEEQWEGTREQRVSSWRDFMKT--GKKGKKGE--IRPPKLKTE 236
           +++E E +E  KR+RE ++ +E +R+ RV SWR+F     GKK KK    +RPPK+K E
Sbjct: 192 REEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKME 250

Homo sapiens (taxid: 9606)
>sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 Back     alignment and function description
>sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=2 SV=2 Back     alignment and function description
>sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=4 SV=1 Back     alignment and function description
>sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q921R4|DJC14_MOUSE DnaJ homolog subfamily C member 14 OS=Mus musculus GN=Dnajc14 PE=2 SV=2 Back     alignment and function description
>sp|Q6Y2X3|DJC14_HUMAN DnaJ homolog subfamily C member 14 OS=Homo sapiens GN=DNAJC14 PE=2 SV=2 Back     alignment and function description
>sp|Q95J56|DJC14_BOVIN DnaJ homolog subfamily C member 14 OS=Bos taurus GN=DNAJC14 PE=1 SV=1 Back     alignment and function description
>sp|Q5XIX0|DJC14_RAT DnaJ homolog subfamily C member 14 OS=Rattus norvegicus GN=Dnajc14 PE=1 SV=1 Back     alignment and function description
>sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
224059208249 predicted protein [Populus trichocarpa] 0.996 1.0 0.912 1e-122
356543664250 PREDICTED: dnaJ homolog subfamily C memb 1.0 1.0 0.868 1e-121
255647685250 unknown [Glycine max] 1.0 1.0 0.868 1e-120
356550066250 PREDICTED: dnaJ homolog subfamily C memb 1.0 1.0 0.864 1e-119
255545347250 J domain-containing protein spf31, putat 1.0 1.0 0.888 1e-119
449442623251 PREDICTED: dnaJ homolog subfamily C memb 1.0 0.996 0.860 1e-117
296084046246 unnamed protein product [Vitis vinifera] 0.98 0.995 0.877 1e-117
359479118305 PREDICTED: J domain-containing protein s 0.992 0.813 0.870 1e-117
357453255250 DnaJ homolog subfamily C member [Medicag 1.0 1.0 0.836 1e-115
224106704250 predicted protein [Populus trichocarpa] 1.0 1.0 0.904 1e-114
>gi|224059208|ref|XP_002299768.1| predicted protein [Populus trichocarpa] gi|222847026|gb|EEE84573.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/250 (91%), Positives = 242/250 (96%), Gaps = 1/250 (0%)

Query: 1   MGDTSASTAADDDLLLKSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKK 60
           MG+ S++TA DD +LLKSFFAEVSEVERDNEV RILSCFKLNPFEYLNLPF+A+P+DIKK
Sbjct: 1   MGEASSTTAYDD-MLLKSFFAEVSEVERDNEVTRILSCFKLNPFEYLNLPFEASPEDIKK 59

Query: 61  QYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQ 120
           QYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLL +EQERDY+LTQV+AAK ELRAKRKKQ
Sbjct: 60  QYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLLEEQERDYVLTQVNAAKEELRAKRKKQ 119

Query: 121 LKKDAASKIKSLVDEGKYEQQYEQSEEFQQELKLKVREILTQQEWRRRKMQMRISEEEGR 180
           L+KD ASKIKSLVDEGKY+QQYEQSEEFQ+ELKLKVREILT QEWRRRKMQMRISEEEGR
Sbjct: 120 LRKDTASKIKSLVDEGKYDQQYEQSEEFQRELKLKVREILTDQEWRRRKMQMRISEEEGR 179

Query: 181 LKKDEEEQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNK 240
           LKKDEEEQKEMWKRKREHEEQWEGTRE+RVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNK
Sbjct: 180 LKKDEEEQKEMWKRKREHEEQWEGTREKRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNK 239

Query: 241 SYVQRPVKRG 250
           SYVQRPVKRG
Sbjct: 240 SYVQRPVKRG 249

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356543664|ref|XP_003540280.1| PREDICTED: dnaJ homolog subfamily C member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|255647685|gb|ACU24304.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356550066|ref|XP_003543411.1| PREDICTED: dnaJ homolog subfamily C member 8-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|255545347|ref|XP_002513734.1| J domain-containing protein spf31, putative [Ricinus communis] gi|223547185|gb|EEF48681.1| J domain-containing protein spf31, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449442623|ref|XP_004139080.1| PREDICTED: dnaJ homolog subfamily C member 8-like isoform 1 [Cucumis sativus] gi|449527209|ref|XP_004170605.1| PREDICTED: dnaJ homolog subfamily C member 8-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|296084046|emb|CBI24434.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479118|ref|XP_002264743.2| PREDICTED: J domain-containing protein spf31 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357453255|ref|XP_003596904.1| DnaJ homolog subfamily C member [Medicago truncatula] gi|355485952|gb|AES67155.1| DnaJ homolog subfamily C member [Medicago truncatula] Back     alignment and taxonomy information
>gi|224106704|ref|XP_002314254.1| predicted protein [Populus trichocarpa] gi|222850662|gb|EEE88209.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:504956462246 AT5G22080 [Arabidopsis thalian 0.936 0.951 0.760 1.5e-92
UNIPROTKB|O75937253 DNAJC8 "DnaJ homolog subfamily 0.824 0.814 0.338 1e-22
MGI|MGI:1915848253 Dnajc8 "DnaJ (Hsp40) homolog, 0.816 0.806 0.336 3.4e-22
POMBASE|SPBC1734.05c209 spf31 "DNAJ protein Spf31 (pre 0.76 0.909 0.322 5.7e-20
ASPGD|ASPL0000056848210 AN0590 [Emericella nidulans (t 0.768 0.914 0.302 6.9e-15
GENEDB_PFALCIPARUM|PF13_0036322 PF13_0036 "DNAJ protein, putat 0.784 0.608 0.274 8e-15
UNIPROTKB|Q8IEP3322 PF13_0036 "DNAJ protein, putat 0.784 0.608 0.274 8e-15
WB|WBGene00001048238 dnj-30 [Caenorhabditis elegans 0.744 0.781 0.278 8.8e-15
CGD|CAL0002460248 orf19.2542 [Candida albicans ( 0.772 0.778 0.277 1.8e-14
UNIPROTKB|Q5A9C3248 CaO19.10076 "Possible DnaJ-lik 0.772 0.778 0.277 1.8e-14
TAIR|locus:504956462 AT5G22080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 922 (329.6 bits), Expect = 1.5e-92, P = 1.5e-92
 Identities = 178/234 (76%), Positives = 194/234 (82%)

Query:    17 KSFFAEVSEVERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKH 76
             KSF AEV EVERDNEV RILSCFKLNPFE+LNL FD++ DD+K+QYRK+SL+VHPDKCKH
Sbjct:    13 KSFLAEVGEVERDNEVGRILSCFKLNPFEHLNLSFDSSTDDVKRQYRKISLMVHPDKCKH 72

Query:    77 PQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGELRAKRKKQLKKDAASKIKSLVDEG 136
             PQA+EAFGALAKAQQLL ++QERDYILTQVHAAK EL+ KRKKQLKKD ASKIKSLVDEG
Sbjct:    73 PQAQEAFGALAKAQQLLLNDQERDYILTQVHAAKEELKMKRKKQLKKDTASKIKSLVDEG 132

Query:   137 KYXXXXXXXXXXXXXLKLKVREILTQQEWRRRKMQMRISXXXXXXXXXXXXQKEMWKRKR 196
             K+             LKLKVREILT QEWRRRKM MRIS            QKE+WK+KR
Sbjct:   133 KHEHIYEQSEEFQKELKLKVREILTDQEWRRRKMAMRISEEEGRLKKDEAEQKEIWKKKR 192

Query:   197 EHEEQWEGTREQRVSSWRDFMKTGKKGKKGEIRPPKLKTEDPNKSYVQRPVKRG 250
             EHEEQWEGTRE+RVSSWRDF K GKK KKGE RPPKLKTEDPNKSYVQRPVK+G
Sbjct:   193 EHEEQWEGTREKRVSSWRDFQKAGKKAKKGETRPPKLKTEDPNKSYVQRPVKKG 246
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
UNIPROTKB|O75937 DNAJC8 "DnaJ homolog subfamily C member 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915848 Dnajc8 "DnaJ (Hsp40) homolog, subfamily C, member 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
POMBASE|SPBC1734.05c spf31 "DNAJ protein Spf31 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056848 AN0590 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF13_0036 PF13_0036 "DNAJ protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IEP3 PF13_0036 "DNAJ protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
WB|WBGene00001048 dnj-30 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0002460 orf19.2542 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A9C3 CaO19.10076 "Possible DnaJ-like splicing factor Spf31" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6NZB0DNJC8_MOUSENo assigned EC number0.34300.8360.8260yesno
Q642C0DNJC8_RATNo assigned EC number0.34300.8360.8260yesno
O75937DNJC8_HUMANNo assigned EC number0.34300.8360.8260yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_I0582
hypothetical protein (249 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-15
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-14
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-12
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 9e-11
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-10
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 7e-10
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-09
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 9e-09
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-08
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-08
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-07
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 4e-07
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-07
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-07
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 9e-07
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-06
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-06
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-06
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-06
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 6e-06
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 7e-06
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 7e-06
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-05
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 4e-05
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-05
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-05
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-04
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-04
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-04
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-04
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-04
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 5e-04
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-04
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 0.001
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 0.004
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 0.004
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information 
 Score = 67.6 bits (166), Expect = 3e-15
 Identities = 24/55 (43%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 42 NPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKH-PQAKEAFGALAKAQQLLSD 95
          + ++ L +P DA+ ++IKK YRKL+L  HPDK    P+A+E F  + +A ++LSD
Sbjct: 1  DYYDILGVPPDASDEEIKKAYRKLALKYHPDKNPDDPEAEEKFKEINEAYEVLSD 55

DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification. Length = 55
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 100.0
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.83
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PRK14288 369 chaperone protein DnaJ; Provisional 99.75
PRK14296 372 chaperone protein DnaJ; Provisional 99.74
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.72
PRK14279 392 chaperone protein DnaJ; Provisional 99.7
PRK14286 372 chaperone protein DnaJ; Provisional 99.7
PRK14287 371 chaperone protein DnaJ; Provisional 99.7
PRK14283 378 chaperone protein DnaJ; Provisional 99.69
PRK14276 380 chaperone protein DnaJ; Provisional 99.69
PRK14291 382 chaperone protein DnaJ; Provisional 99.69
PRK14299291 chaperone protein DnaJ; Provisional 99.69
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.68
PRK14298 377 chaperone protein DnaJ; Provisional 99.68
PRK14280 376 chaperone protein DnaJ; Provisional 99.67
PRK14278 378 chaperone protein DnaJ; Provisional 99.67
PRK14285 365 chaperone protein DnaJ; Provisional 99.66
PRK14277 386 chaperone protein DnaJ; Provisional 99.66
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.66
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PRK14294 366 chaperone protein DnaJ; Provisional 99.66
PRK14282 369 chaperone protein DnaJ; Provisional 99.66
PRK14284 391 chaperone protein DnaJ; Provisional 99.65
PRK14295 389 chaperone protein DnaJ; Provisional 99.65
PRK14301 373 chaperone protein DnaJ; Provisional 99.65
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
PRK14297 380 chaperone protein DnaJ; Provisional 99.64
PRK10767 371 chaperone protein DnaJ; Provisional 99.64
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.63
PRK14281 397 chaperone protein DnaJ; Provisional 99.63
PRK14293 374 chaperone protein DnaJ; Provisional 99.63
PRK14300 372 chaperone protein DnaJ; Provisional 99.63
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.62
PRK14292 371 chaperone protein DnaJ; Provisional 99.62
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.61
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.61
PRK14289 386 chaperone protein DnaJ; Provisional 99.61
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
PRK14290 365 chaperone protein DnaJ; Provisional 99.59
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.49
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.48
PRK05014171 hscB co-chaperone HscB; Provisional 99.41
PHA03102153 Small T antigen; Reviewed 99.41
PRK01356166 hscB co-chaperone HscB; Provisional 99.41
PRK00294173 hscB co-chaperone HscB; Provisional 99.36
PRK03578176 hscB co-chaperone HscB; Provisional 99.35
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.25
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.19
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.13
PTZ00100116 DnaJ chaperone protein; Provisional 99.12
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.11
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.08
PRK01773173 hscB co-chaperone HscB; Provisional 99.03
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.01
PHA02624 647 large T antigen; Provisional 98.97
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.87
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.61
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.97
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.9
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.85
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.28
KOG0431453 consensus Auxilin-like protein and related protein 96.55
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.22
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.91
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 92.99
PF12339132 DNAJ_related: DNA-J related protein ; InterPro: IP 86.64
PF1344662 RPT: A repeated domain in UCH-protein 82.33
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-54  Score=369.04  Aligned_cols=221  Identities=37%  Similarity=0.626  Sum_probs=201.1

Q ss_pred             CCcCChHHHHHHHHHHHhhhhh-------hHHHHHHH----hcCCCCccccccCCCCCCHHHHHHHHHHHHHHhCCCCCC
Q 025594            7 STAADDDLLLKSFFAEVSEVER-------DNEVLRIL----SCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCK   75 (250)
Q Consensus         7 ~~~~~~~~~~~~f~~e~~~i~~-------d~ei~rll----~~~~~d~Y~vLgv~~~as~~eIkkaYRklsl~~HPDk~~   75 (250)
                      ..+++..+.|..||+||++|++       .+||+|||    +||++|||+||+|.|+++.++|++.||+||+++|||||+
T Consensus         8 ~~~g~t~~~f~~Fy~evk~~ek~d~vLts~~qIeRllrpgstyfnLNpfeVLqIdpev~~edikkryRklSilVHPDKN~   87 (250)
T KOG1150|consen    8 GGGGTTMEAFETFYQEVKSIEKRDSVLTSKQQIERLLRPGSTYFNLNPFEVLQIDPEVTDEDIKKRYRKLSILVHPDKNP   87 (250)
T ss_pred             CCCCCcHHHHHHHHHHHHhhhhhhcccCcHHHHHHHhcCCccccccChHHHHhcCCCCCHHHHHHHHHhhheeecCCCCc
Confidence            4566678999999999999998       38999999    479999999999999999999999999999999999998


Q ss_pred             C--chHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHH---HHHHHHHHhhHhhhhhhhhhcccchhhhhhcCcHHHHH
Q 025594           76 H--PQAKEAFGALAKAQQLLSDEQERDYILTQVHAAKGE---LRAKRKKQLKKDAASKIKSLVDEGKYEQQYEQSEEFQQ  150 (250)
Q Consensus        76 ~--~~a~~~f~~I~~Ay~vL~dp~~R~~YD~~~~~a~~~---~~~e~kk~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~  150 (250)
                      +  +.|+.+|..|.+||..|.|+..|..++..+.+|+..   ++.++++++++++.+.+   +.++       +|..|++
T Consensus        88 Dd~~rAqkAFdivkKA~k~l~n~~~rkr~~~~y~~ak~~~~~~~~ekkkklkKegkpt~---ieed-------Dp~lfk~  157 (250)
T KOG1150|consen   88 DDAERAQKAFDIVKKAYKLLENDKIRKRCLDVYTAAKNRLEKVMSEKKKKLKKEGKPTI---IEED-------DPELFKQ  157 (250)
T ss_pred             ccHHHHHHHHHHHHHHHHHHhCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCC---cccc-------CHHHHHH
Confidence            5  689999999999999999999999999999999874   47788999999877644   4444       7999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhHHHhhhccc-----cccC
Q 025594          151 ELKLKVREILTQQEWRRRKMQMRISEEEGRLKKDEEEQKEMWKRKREHEEQWEGTREQRVSSWRDFMKTGK-----KGKK  225 (250)
Q Consensus       151 ~~~~~~~kl~~e~E~rrr~~~~~~~~e~~R~~e~e~e~~e~~k~k~e~~k~wE~~Rd~RV~sWr~f~~~~k-----k~k~  225 (250)
                      +|+.++++||+++|++|.+++++.++|++|.++.++++++.+|+.+||++|||+|||+||+|||+||.+++     |+.+
T Consensus       158 av~~~~mklfae~erkRk~~e~r~~~eRkr~re~eIeaeek~Kr~~E~qKnfEEsRd~Rv~sWrnFq~~t~K~kk~Kknk  237 (250)
T KOG1150|consen  158 AVYKQVMKLFAELERKRKELEARANEERKRQREEEIEAEEKRKREREWQKNFEESRDGRVGSWRNFQAKTKKGKKEKKNK  237 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhcccccchHHHHHHhhhcchhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999997653     2234


Q ss_pred             CCCCCCCCCCCC
Q 025594          226 GEIRPPKLKTED  237 (250)
Q Consensus       226 ~~~~ppk~k~e~  237 (250)
                      +.|+||++|||+
T Consensus       238 ~~~~pPkvk~e~  249 (250)
T KOG1150|consen  238 TFLRPPKVKMEQ  249 (250)
T ss_pred             cccCCCcccccC
Confidence            669999999986

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF12339 DNAJ_related: DNA-J related protein ; InterPro: IPR021059 This domain family is approximately 130 amino acids in length and contains a conserved YYLD sequence motif Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 8e-08
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-06
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-06
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 8e-06
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 1e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 2e-05
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-05
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-05
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 4e-05
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 6e-05
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 9e-05
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-04
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 8e-04
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%)
Query: 32 VLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQ 91
          +L+ LS    +P+  L +   A+  DIKK Y+KL+   HPDK K P A++ F  ++KA +
Sbjct: 8  ILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYE 67
Query: 92 LLSDEQER 99
          +LS+E++R
Sbjct: 68 ILSNEEKR 75
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-15
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-11
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-11
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 8e-11
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-10
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 9e-10
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-09
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 5e-09
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 7e-09
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 8e-09
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-08
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-08
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-08
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-08
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 5e-08
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 8e-08
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-07
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-07
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-07
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-07
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 5e-07
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 5e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 5e-06
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 8e-06
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 8e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-05
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 4e-05
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 8e-05
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 8e-05
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 9e-05
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-04
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-04
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 69.0 bits (169), Expect = 1e-15
 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 27 ERDNEVLRILSCFKLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGAL 86
          E+ + + RI +    + ++ L +   A+ D++ K YRKL++L+HPDKC  P +++AF A+
Sbjct: 15 EQADAIRRIRNS--KDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAV 72

Query: 87 AKAQQLLSDEQER 99
            A+  L    + 
Sbjct: 73 VNARTALLKNIKS 85
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.81
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.8
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.79
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.78
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.77
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.77
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.77
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.76
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.75
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.75
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.74
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.74
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.74
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.74
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.73
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.73
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.71
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.68
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.67
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.66
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.64
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.63
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.62
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.6
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.58
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.56
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.55
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.55
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.55
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.55
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.54
2guz_A71 Mitochondrial import inner membrane translocase su 99.46
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.42
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.83
2guz_B65 Mitochondrial import inner membrane translocase su 98.63
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 85.76
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.81  E-value=2.5e-20  Score=136.55  Aligned_cols=69  Identities=33%  Similarity=0.506  Sum_probs=65.7

Q ss_pred             CCCccccccCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Q 025594           40 KLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQERDYILTQVHA  108 (250)
Q Consensus        40 ~~d~Y~vLgv~~~as~~eIkkaYRklsl~~HPDk~~~~~a~~~f~~I~~Ay~vL~dp~~R~~YD~~~~~  108 (250)
                      +.|||+||||++++|..+|+++|+++++.+|||+++++.+.+.|..|+.||++|+||.+|..||.++..
T Consensus         2 ~~~~y~iLgv~~~as~~~Ik~ayr~l~~~~HPD~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~   70 (77)
T 1hdj_A            2 GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE   70 (77)
T ss_dssp             CCCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGG
T ss_pred             CCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHHccc
Confidence            469999999999999999999999999999999999888999999999999999999999999998753
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 8e-07
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-06
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-06
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-05
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-05
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 5e-04
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 0.001
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.6 bits (102), Expect = 8e-07
 Identities = 23/58 (39%), Positives = 38/58 (65%)

Query: 42 NPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLSDEQER 99
          + ++ L L   A+ ++IK+ YR+ +L  HPDK K P A+E F  +A+A  +LSD ++R
Sbjct: 4  DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKR 61
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.84
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.74
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.68
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.65
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.61
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.54
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.47
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.84  E-value=2.6e-21  Score=140.14  Aligned_cols=69  Identities=29%  Similarity=0.466  Sum_probs=64.0

Q ss_pred             CCCccccccCCCCCCHHHHHHHHHHHHHHhCCCCCCC-chHHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Q 025594           40 KLNPFEYLNLPFDATPDDIKKQYRKLSLLVHPDKCKH-PQAKEAFGALAKAQQLLSDEQERDYILTQVHA  108 (250)
Q Consensus        40 ~~d~Y~vLgv~~~as~~eIkkaYRklsl~~HPDk~~~-~~a~~~f~~I~~Ay~vL~dp~~R~~YD~~~~~  108 (250)
                      ..|||+||||+++||.++|+++|+++++.+|||++++ +.+...|..|+.||+||+||.+|..||.+|..
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            4699999999999999999999999999999999974 56778899999999999999999999998753
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure