Citrus Sinensis ID: 025600

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250

MPGIAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGAATPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAIAYTVAFICPNTHEQLPSTDF

ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccHHHHHHHHHHHHHHHHHHHEEEECcccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccCEEEHHHHHHHHHHHHHHHHHHcccccccccccccc

**G**IGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGAATPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAIAYTVAFICPN**********

xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable aquaporin TIP1-2	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. May be involved in transport from the vacuolar compartment to the cytoplasm.	confident	Q94CS9
Aquaporin TIP1-3	Potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.	confident	O82598
Probable aquaporin TIP-type	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	probable	P42067

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J4N, chain A
Confidence level:very confident
Coverage over the Query: 10-239
View the alignment between query and template
View the model in PyMOL