Citrus Sinensis ID: 025602

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MAGKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDANHHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDDDDREAPILFDYVPVQSQCSYGCKEEKSSGSDHEYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNMDNHIIQASLQSNLGFW
ccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHccccHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccc
ccccccccccHHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
magkrktpccskgeglnrgawKAVEDKILTDYIKAYGegkwrhipkaaglkrcgkSCRLRWMnylrpdikrgnfskdEEDLVIRLHKLLGNRWALiagrlpgrtdndiknywntklskrvdanhhhhqnrskvekkpktrsssgvvprpqykktekhdaaggvadddddreapilfdyvpvqsqcsygckeekssgsdheytvdfdvGGKSLLDLLDANLnnlddfghdiynNMDNHIIQASLQSNLGFW
magkrktpccskgeglnrgawkaveDKILTDYIKAYgegkwrhipkaaglkrcgkscrLRWMNylrpdikrgnfskdEEDLVIRLHKLLGNRWAliagrlpgrtdndIKNYWNTKLskrvdanhhhhqnrskvekkpktrsssgvvprpqykktekhdaaggvadddDDREAPILFDYVPVQSQCSYGCKeekssgsdhEYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNMDNHIIQASLQSNLGFW
MAGKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDANHHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHdaaggvadddddREAPILFDYVPVQSQCSYGCKEEKSSGSDHEYTVDFDVGGKSlldlldanlnnlddFGHDIYNNMDNHIIQASLQSNLGFW
**************GLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNT**********************************************************PILFDYVPVQSQCSYGC**********EYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNMDNHIIQASL*******
******T*CCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLS************************************************************************************TVDFDVGGKSLLDLLDANLNNLDDFG****************QSNLGFW
***********KGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVD*******************************************DDDDDREAPILFDYVPVQSQCS*************EYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNMDNHIIQASLQSNLGFW
******TPCCSK*EGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDAN********************************************************************EKSS**DHEYTVDF**GGKSLLDLLDANLN****************************W
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDANHHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDDDDREAPILFDYVPVQSQCSYGCKEEKSSGSDHEYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNMDNHIIQASLQSNLGFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
Q9S9K9257 Transcription factor MYB3 yes no 0.744 0.723 0.463 4e-46
Q38850249 Transcription repressor M no no 0.652 0.654 0.514 7e-45
P10290273 Anthocyanin regulatory C1 N/A no 0.428 0.391 0.731 1e-44
Q38851236 Transcription repressor M no no 0.54 0.572 0.578 5e-44
Q9FJA2258 Transcription factor TT2 no no 0.516 0.5 0.661 2e-43
Q9SZP1282 Transcription repressor M no no 0.456 0.404 0.660 2e-43
P20026267 Myb-related protein Hv1 O N/A no 0.464 0.434 0.666 3e-43
P81393232 Myb-related protein 308 O N/A no 0.492 0.530 0.620 8e-43
Q7XBH4257 Myb-related protein Myb4 no no 0.464 0.451 0.666 9e-43
P20025255 Myb-related protein Zm38 N/A no 0.456 0.447 0.660 1e-42
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function desciption
 Score =  184 bits (468), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 136/207 (65%), Gaps = 21/207 (10%)

Query: 6   KTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYL 65
           ++PCC K   +N+GAW   ED++L DYI+ +GEG WR +P+AAGL+RCGKSCRLRWMNYL
Sbjct: 3   RSPCCEKAH-MNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61

Query: 66  RPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTK-----LSKRV 120
           RPD+KRGNF+++E++L+I+LH LLGN+W+LIAGRLPGRTDN+IKNYWNT      LS+ +
Sbjct: 62  RPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRGI 121

Query: 121 DANHHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDDDDREAPILFDYVP 180
           D N H   N S V   P +  +  V       +T   D +G V  +      P+  +   
Sbjct: 122 DPNSHRLINESVV--SPSSLQNDVV-------ETIHLDFSGPVKPE------PVREEIGM 166

Query: 181 VQSQCSYGCKEEKSSGSDHEYTVDFDV 207
           V +  S G   EK  G++ ++ ++ ++
Sbjct: 167 VNNCESSGTTSEKDYGNEEDWVLNLEL 193

Arabidopsis thaliana (taxid: 3702)
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
343887319251 MYB transcription factor [Citrus unshiu] 1.0 0.996 0.980 1e-122
296081710278 unnamed protein product [Vitis vinifera] 0.816 0.733 0.534 2e-56
225429662272 PREDICTED: transcription factor TT2-like 0.824 0.757 0.489 3e-55
297743013323 unnamed protein product [Vitis vinifera] 0.852 0.659 0.489 9e-55
13346186302 GHMYB10 [Gossypium hirsutum] 0.852 0.705 0.460 3e-54
147861236265 hypothetical protein VITISV_038222 [Viti 0.696 0.656 0.591 5e-54
147810820300 hypothetical protein VITISV_034452 [Viti 0.868 0.723 0.466 8e-54
225442142301 PREDICTED: transcription factor TT2 [Vit 0.868 0.720 0.466 1e-53
296081708265 unnamed protein product [Vitis vinifera] 0.696 0.656 0.585 2e-53
359484279301 PREDICTED: transcription factor TT2-like 0.86 0.714 0.483 3e-53
>gi|343887319|dbj|BAK61865.1| MYB transcription factor [Citrus unshiu] Back     alignment and taxonomy information
 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 246/251 (98%), Positives = 248/251 (98%), Gaps = 1/251 (0%)

Query: 1   MAGKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLR 60
           MAGKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKA+GEGKWRHIPKAAGLKRCGKSCRLR
Sbjct: 1   MAGKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAHGEGKWRHIPKAAGLKRCGKSCRLR 60

Query: 61  WMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRV 120
           WMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRV
Sbjct: 61  WMNYLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRV 120

Query: 121 DAN-HHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDDDDREAPILFDYV 179
           DAN HHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDDDDREAPILFDYV
Sbjct: 121 DANHHHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDDDDREAPILFDYV 180

Query: 180 PVQSQCSYGCKEEKSSGSDHEYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNMDNHII 239
           PVQSQ SYGCKEEKSSGSDHEYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNN DNHII
Sbjct: 181 PVQSQFSYGCKEEKSSGSDHEYTVDFDVGGKSLLDLLDANLNNLDDFGHDIYNNRDNHII 240

Query: 240 QASLQSNLGFW 250
           QASLQS+LGFW
Sbjct: 241 QASLQSDLGFW 251

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296081710|emb|CBI20715.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429662|ref|XP_002279900.1| PREDICTED: transcription factor TT2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743013|emb|CBI35880.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|13346186|gb|AAK19615.1|AF336282_1 GHMYB10 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|147861236|emb|CAN78909.1| hypothetical protein VITISV_038222 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147810820|emb|CAN60723.1| hypothetical protein VITISV_034452 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442142|ref|XP_002275148.1| PREDICTED: transcription factor TT2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081708|emb|CBI20713.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484279|ref|XP_003633091.1| PREDICTED: transcription factor TT2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.46 0.354 0.626 1.2e-45
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.508 0.494 0.624 1.6e-45
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.6 0.557 0.556 7.1e-45
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.556 0.558 0.582 9.1e-45
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.56 0.593 0.577 3.1e-44
TAIR|locus:2169538258 TT2 "TRANSPARENT TESTA 2" [Ara 0.516 0.5 0.661 2.2e-43
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.524 0.464 0.597 3.5e-43
TAIR|locus:2062040 371 MYB12 "myb domain protein 12" 0.584 0.393 0.554 1.5e-42
TAIR|locus:2155944342 MYB111 "myb domain protein 111 0.6 0.438 0.551 1.5e-42
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.548 0.5 0.566 3.2e-42
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 431 (156.8 bits), Expect = 1.2e-45, Sum P(3) = 1.2e-45
 Identities = 72/115 (62%), Positives = 90/115 (78%)

Query:     6 KTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYL 65
             ++PCC K  GL +G W   ED+ L DYI  +G G WR +PK AGL+RCGKSCRLRW NYL
Sbjct:     3 RSPCCEKKNGLKKGPWTPEEDQKLIDYINIHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 62

Query:    66 RPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRV 120
             RPDIKRG FS +EE+ +I+LH ++GN+W+ IA RLPGRTDN+IKNYWNT + KR+
Sbjct:    63 RPDIKRGRFSFEEEETIIQLHSIMGNKWSAIAARLPGRTDNEIKNYWNTHIRKRL 117
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;RCA
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169538 TT2 "TRANSPARENT TESTA 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062040 MYB12 "myb domain protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155944 MYB111 "myb domain protein 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034097001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (301 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 1e-55
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-48
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 7e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-13
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-05
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 1e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  178 bits (452), Expect = 1e-55
 Identities = 87/169 (51%), Positives = 109/169 (64%), Gaps = 6/169 (3%)

Query: 4   KRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMN 63
           K+ TPCC+K  G+ RG W   ED+IL  +IK  GEG+WR +PK AGL RCGKSCRLRWMN
Sbjct: 12  KKTTPCCTK-MGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMN 70

Query: 64  YLRPDIKRGNFSKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKR---- 119
           YLRP +KRG  + DEEDL++RLH+LLGNRW+LIAGR+PGRTDN+IKNYWNT L K+    
Sbjct: 71  YLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQ 130

Query: 120 -VDANHHHHQNRSKVEKKPKTRSSSGVVPRPQYKKTEKHDAAGGVADDD 167
            +D   H   + + + K  +  S     P      +   D      D D
Sbjct: 131 GIDPQTHKPLDANNIHKPEEEVSGGQKYPIEPISSSHTDDTTVNGGDGD 179

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.76
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.69
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.61
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.58
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.5
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.49
PLN03212249 Transcription repressor MYB5; Provisional 99.43
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.42
PLN03091 459 hypothetical protein; Provisional 99.37
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.31
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.23
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.17
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.14
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.11
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.04
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.9
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.51
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.08
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.02
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.77
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.59
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.58
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.39
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.39
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.33
KOG1279506 consensus Chromatin remodeling factor subunit and 97.14
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.95
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.93
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.89
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.83
KOG1279506 consensus Chromatin remodeling factor subunit and 96.82
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.61
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.55
PRK13923170 putative spore coat protein regulator protein YlbO 96.55
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.17
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.6
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.54
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.49
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.46
PRK13923170 putative spore coat protein regulator protein YlbO 94.61
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.49
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.43
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.07
KOG4282345 consensus Transcription factor GT-2 and related pr 92.41
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 90.99
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.64
KOG1194 534 consensus Predicted DNA-binding protein, contains 90.36
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 88.08
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 87.57
KOG4282345 consensus Transcription factor GT-2 and related pr 83.66
KOG4167 907 consensus Predicted DNA-binding protein, contains 81.83
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 81.07
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2e-38  Score=276.08  Aligned_cols=126  Identities=63%  Similarity=1.248  Sum_probs=118.9

Q ss_pred             CCCCCcccccCCCCCCCCCCHHHHHHHHHHHHHhCCCCccchhhhcCCccccccccccccccccCCccCCCCCHHHHHHH
Q 025602            3 GKRKTPCCSKGEGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKDEEDLV   82 (250)
Q Consensus         3 g~~~~~c~~k~~~i~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~Rt~~qcr~Rw~~~L~p~l~~~~WT~eEd~~L   82 (250)
                      +..+.|||.| ++++|++||+|||++|+++|++||..+|..||+.++.+|+++|||+||.++|+|.+++++||.|||++|
T Consensus        11 ~~~~~pcc~K-~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lL   89 (249)
T PLN03212         11 SKKTTPCCTK-MGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLI   89 (249)
T ss_pred             CCCCCCCccc-CCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHH
Confidence            4567899999 999999999999999999999999989999999996699999999999999999999999999999999


Q ss_pred             HHHHHHhCCCHHHHhhhCCCCCHHHHHHHHHHhhhhhhhcCCCCCCC
Q 025602           83 IRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDANHHHHQN  129 (250)
Q Consensus        83 l~~~~~~g~~W~~Ia~~lpgRT~~~~knrw~~~l~k~~~~~~~~~~~  129 (250)
                      ++++.+||++|+.||++|||||+++|||||+.++++++...+..+..
T Consensus        90 lel~~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p~~  136 (249)
T PLN03212         90 LRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQT  136 (249)
T ss_pred             HHHHHhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCCCC
Confidence            99999999999999999999999999999999999998876665543

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 4e-22
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 7e-22
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 5e-20
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 5e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 5e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 7e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-10
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 9e-10
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 9e-10
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 7e-07
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (251), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 73/108 (67%), Gaps = 3/108 (2%)
Query: 16  LNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLK-RCGKSCRLRWMNYLRPDIKRGNF 74
           L +G W   ED+ + + +K YG  +W  I  A  LK R GK CR RW N+L P++K+ ++
Sbjct: 5   LVKGPWTKEEDQKVIELVKKYGTKQWTLI--AKHLKGRLGKQCRERWHNHLNPEVKKSSW 62
Query: 75  SKDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDA 122
           +++E+ ++   HK+LGNRWA IA  LPGRTDN +KN+WN+ + ++VD 
Sbjct: 63  TEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKVDT 110
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-61
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-59
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-58
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-51
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 2e-48
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-47
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-27
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-22
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-22
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 9e-17
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 6e-06
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-12
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-04
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 9e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 9e-07
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 3e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 4e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 4e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  188 bits (480), Expect = 2e-61
 Identities = 41/125 (32%), Positives = 69/125 (55%), Gaps = 1/125 (0%)

Query: 18  RGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFSKD 77
           +G +   ED ++ +Y+K  G   W  I       R  K CR RW N+L P + +  ++ +
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLPN-RSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 78  EEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRVDANHHHHQNRSKVEKKP 137
           E++ + R +  LG++W++IA  +PGRTDN IKN WN+ +SKR+  N +H +       K 
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 138 KTRSS 142
           +  + 
Sbjct: 121 RKAAD 125
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.87
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.84
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.79
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.75
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.75
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.74
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.74
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.73
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.72
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.7
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.69
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.69
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.67
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.66
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.66
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.63
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.63
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.62
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.62
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.61
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.61
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.6
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.59
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.59
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.58
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.58
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.57
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.55
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.53
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.53
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.52
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.51
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.51
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.25
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.5
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.45
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.43
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.14
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.36
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.34
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.34
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.3
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.3
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.26
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.25
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.24
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.16
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.11
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.02
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.02
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.95
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.9
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.88
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.83
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.71
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.67
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.61
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.61
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.56
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.48
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.28
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.28
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.27
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.17
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.14
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.42
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.11
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.02
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.96
2crg_A70 Metastasis associated protein MTA3; transcription 97.83
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.79
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.79
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.66
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.46
2crg_A70 Metastasis associated protein MTA3; transcription 97.42
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.25
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.16
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.11
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.94
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.96
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.55
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.98
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.61
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.47
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 93.14
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.5
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 90.33
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 80.07
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=100.00  E-value=1.2e-37  Score=249.35  Aligned_cols=119  Identities=39%  Similarity=0.821  Sum_probs=102.3

Q ss_pred             CCCCCCCcccccC-----CCCCCCCCCHHHHHHHHHHHHHhCCCCccchhhhcCCccccccccccccccccCCccCCCCC
Q 025602            1 MAGKRKTPCCSKG-----EGLNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPDIKRGNFS   75 (250)
Q Consensus         1 m~g~~~~~c~~k~-----~~i~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~Rt~~qcr~Rw~~~L~p~l~~~~WT   75 (250)
                      |+||+..+|+.+|     |++++|+||+|||++|+++|.+||.++|..||..|+ +|++.||++||.++|+|.+++++||
T Consensus         5 ~~~Rt~~qC~~Rw~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~WT   83 (128)
T 1h8a_C            5 IKNRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWT   83 (128)
T ss_dssp             -----------------CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSS-SCCHHHHHHHHHHTTCSSSCCSCCC
T ss_pred             cCCCCHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhc-CCcHHHHHHHHHHhcccccccccCC
Confidence            7899999999986     899999999999999999999999888999999998 9999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCHHHHhhhCCCCCHHHHHHHHHHhhhhhh
Q 025602           76 KDEEDLVIRLHKLLGNRWALIAGRLPGRTDNDIKNYWNTKLSKRV  120 (250)
Q Consensus        76 ~eEd~~Ll~~~~~~g~~W~~Ia~~lpgRT~~~~knrw~~~l~k~~  120 (250)
                      +|||.+|++++.+||++|+.||++|||||+++|++||+.++++++
T Consensus        84 ~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~r~~~~~~~~~  128 (128)
T 1h8a_C           84 EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV  128 (128)
T ss_dssp             HHHHHHHHHHHHHHCSCHHHHGGGSTTCCHHHHHHHHHTTTTC--
T ss_pred             HHHHHHHHHHHHHHCcCHHHHHHHCCCCCHHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999999998764
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-16
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-16
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-08
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 1e-13
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-12
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-11
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 9e-12
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-04
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-11
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-04
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-09
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 9e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 6e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-04
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-07
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-07
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 6e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-04
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 3e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 69.8 bits (171), Expect = 1e-16
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 16 LNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPD 68
          L +G W   ED+ L   ++ YG  +W  I K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.78
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.77
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.66
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.65
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.63
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.56
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.55
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.53
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.48
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.48
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.47
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.4
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.37
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.36
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.32
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.31
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.22
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.2
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.17
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.07
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.04
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.85
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.25
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.21
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.01
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.91
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.4
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.16
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.84
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.7
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.36
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.28
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.35
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 91.58
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 91.54
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 82.62
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.78  E-value=2.1e-20  Score=125.35  Aligned_cols=52  Identities=40%  Similarity=0.832  Sum_probs=50.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCCccchhhhcCCccccccccccccccccCC
Q 025602           16 LNRGAWKAVEDKILTDYIKAYGEGKWRHIPKAAGLKRCGKSCRLRWMNYLRPD   68 (250)
Q Consensus        16 i~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~Rt~~qcr~Rw~~~L~p~   68 (250)
                      |+||+||+|||++|+++|.+||.++|..||+.|+ +||+.||++||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence            5799999999999999999999889999999999 999999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure