Citrus Sinensis ID: 025607


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MLISNYIKIPLEPYVYVHGHSDKQLTRILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLMEEIAQNCRNFRELKIMGPFDLLFASTLNMYLPKLKVLSLRCTTLNRDALILILDGLQNLEVLNISHCLLIDVPLAPAPKKIIKKLDRTILQKAARLRKFLTCMEDSCIMCQRTKNDEGIMRWYKYEEGLWKDDEVLPAIVLCI
cccccccccccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccccEEcccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccHccccccccHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccccEEEccccccccccccccccHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccccccccccccc
*LISNYIKIPLEPYVYVHGHSDKQLTRILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLMEEIAQNCRNFRELKIMGPFDLLFASTLNMYLPKLKVLSLRCTTLNRDALILILDGLQNLEVLNISHCLLIDVPLAPAPKKIIKKLDRTILQKAARLRKFLTCMEDSCIMCQRTKNDEGIMRWYKYEEGLWKDDEVLPAIVLCI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLISNYIKIPLEPYVYVHGHSDKQLTRILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLMEEIAQNCRNFRELKIMGPFDLLFASTLNMYLPKLKVLSLRCTTLNRDALILILDGLQNLEVLNISHCLLIDVPLAPAPKKIIKKLDRTILQKAARLRKFLTCMEDSCIMCQRTKNDEGIMRWYKYEEGLWKDDEVLPAIVLCI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box/LRR-repeat protein At3g48880 probableQ9M2Z5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 34-176
View the alignment between query and template
View the model in PyMOL
Template: 2AST, chain B
Confidence level:very confident
Coverage over the Query: 4-178
View the alignment between query and template
View the model in PyMOL