Citrus Sinensis ID: 025613


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGAQ
cccccccccccEEECccccccHHHHHHHHcccccccccccccccCEEEEEcccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccCCccccccHHHHHHHHHHcccccccEEcccccEEEEEEcHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEcccccHHHHHHHHHHccccCCcEEccccEEEEEEEHHHHHHHHHHcccccccccc
*******HSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTL*****A*SSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBS domain-containing protein CBSX1, chloroplastic probableO23193

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SL7, chain A
Confidence level:very confident
Coverage over the Query: 82-145,165-245
View the alignment between query and template
View the model in PyMOL
Template: 2YZQ, chain A
Confidence level:very confident
Coverage over the Query: 33-150,180-239
View the alignment between query and template
View the model in PyMOL
Template: 1VRD, chain A
Confidence level:very confident
Coverage over the Query: 2-95
View the alignment between query and template
View the model in PyMOL