Citrus Sinensis ID: 025613


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGAQ
cccccccccccEEEEcccccHHHHHHHHHHccccccccccccccEEEEEEcccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccEEccccccHHHHHHHHHHcccccccEEcccccEEEEEEHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEcccccHHHHHHHHHHccccEEcEEccccEEEEEEEHHHHHHHHHHcccccccccc
ccEEEEcccccEEEcccccccccEEEEcccEEEcccEcccccccccHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHccEHHHHccccccEEEEcccccccHcHHHHHHHHHHHccccccEEEcccccEEEEEEcHHHHHHHHccccccccccccccHHHHcccHHHHHHHHHHHccccHHHccccccEEEcccccHHHHHHHHHHccccccEEEccccEEEEEEEHHHHHHHHHcccHcHccccc
mdsivlphsisvarlrappagrtsgrtsfalqlpclllsrpgcrvfSVLATSSDRVSALRRSSAvfasgtltansaapssgvytvgdfmttkeelhvvkptttvdeafVPTALEILVEKritgfpvidddwklvglvsdydllaldsisgsgradnsmfpevdsTWKTFNEVQKLLSKtngkmvgdlmtpapvvvRETTNLEDAARLLLETKyrrlpvvdadgklvgiITRGNVVRAALQIKHATEMGAQ
mdsivlphsisvarlrappagrtsgRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVfasgtltansaapssgvYTVGDFMTTKEELHvvkptttvdeafVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSisgsgradnSMFPEVDSTWKTFNEVQKLLsktngkmvgdlMTPAPVVVRETTNLEDAARLLletkyrrlpvvdadgklvgiiTRGNVVRAALQIKHATEMGAQ
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGAQ
**************************TSFALQLPCLLLSRPGCRVFSVLATSSDRVSAL****AVFASGTL********SGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISG********FPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIK********
*******HSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVF**********A*SSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQ**********
MDSIVLPHSISVARLR*********RTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGAQ
*DSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGAQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
O23193236 CBS domain-containing pro yes no 0.732 0.775 0.797 8e-82
Q9C5D0238 CBS domain-containing pro no no 0.728 0.764 0.686 7e-72
Q58821168 Uncharacterized protein M yes no 0.6 0.892 0.273 6e-12
O58045 486 Inosine-5'-monophosphate yes no 0.408 0.209 0.305 5e-08
Q9UY49 485 Inosine-5'-monophosphate no no 0.408 0.210 0.291 8e-08
P42851 485 Inosine-5'-monophosphate yes no 0.408 0.210 0.284 1e-07
O67820 490 Inosine-5'-monophosphate yes no 0.444 0.226 0.271 4e-07
P65167 529 Inosine-5'-monophosphate yes no 0.34 0.160 0.322 2e-06
P65168 529 Inosine-5'-monophosphate yes no 0.34 0.160 0.322 2e-06
Q57647 265 Uncharacterized protein M no no 0.48 0.452 0.261 1e-05
>sp|O23193|CBSX1_ARATH CBS domain-containing protein CBSX1, chloroplastic OS=Arabidopsis thaliana GN=CBSX1 PE=1 SV=2 Back     alignment and function desciption
 Score =  303 bits (776), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 150/188 (79%), Positives = 166/188 (88%), Gaps = 5/188 (2%)

Query: 62  SSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRI 121
           S++  A  TL  NS++P SGVYTVG+FMT KE+LHVVKPTTTVDEA     LE+LVE RI
Sbjct: 54  SASSAAGSTLMTNSSSPRSGVYTVGEFMTKKEDLHVVKPTTTVDEA-----LELLVENRI 108

Query: 122 TGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNG 181
           TGFPVID+DWKLVGLVSDYDLLALDSISGSGR +NSMFPEVDSTWKTFN VQKLLSKTNG
Sbjct: 109 TGFPVIDEDWKLVGLVSDYDLLALDSISGSGRTENSMFPEVDSTWKTFNAVQKLLSKTNG 168

Query: 182 KMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQI 241
           K+VGDLMTPAP+VV E TNLEDAA++LLETKYRRLPVVD+DGKLVGIITRGNVVRAALQI
Sbjct: 169 KLVGDLMTPAPLVVEEKTNLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQI 228

Query: 242 KHATEMGA 249
           K + +  A
Sbjct: 229 KRSGDRNA 236





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C5D0|CBSX2_ARATH CBS domain-containing protein CBSX2, chloroplastic OS=Arabidopsis thaliana GN=CBSX2 PE=1 SV=1 Back     alignment and function description
>sp|Q58821|Y1426_METJA Uncharacterized protein MJ1426 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1426 PE=4 SV=1 Back     alignment and function description
>sp|O58045|IMDH_PYRHO Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=guaB PE=1 SV=1 Back     alignment and function description
>sp|Q9UY49|IMDH_PYRAB Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=guaB PE=3 SV=1 Back     alignment and function description
>sp|P42851|IMDH_PYRFU Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=guaB PE=3 SV=1 Back     alignment and function description
>sp|O67820|IMDH_AQUAE Inosine-5'-monophosphate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=guaB PE=3 SV=1 Back     alignment and function description
>sp|P65167|IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis GN=guaB PE=1 SV=1 Back     alignment and function description
>sp|P65168|IMDH_MYCBO Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=guaB PE=3 SV=1 Back     alignment and function description
>sp|Q57647|Y188_METJA Uncharacterized protein MJ0188 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0188 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
225438783246 PREDICTED: CBS domain-containing protein 0.964 0.979 0.726 4e-93
317106695236 JHL03K20.5 [Jatropha curcas] 0.92 0.974 0.746 5e-91
255587643239 conserved hypothetical protein [Ricinus 0.832 0.870 0.789 1e-86
147802944288 hypothetical protein VITISV_021555 [Viti 0.964 0.836 0.621 2e-86
224081731208 predicted protein [Populus trichocarpa] 0.82 0.985 0.759 9e-85
449443418235 PREDICTED: CBS domain-containing protein 0.876 0.931 0.690 7e-83
449525190235 PREDICTED: CBS domain-containing protein 0.876 0.931 0.690 1e-82
15234564236 cystathionine beta-synthase domain-conta 0.732 0.775 0.797 5e-80
297802232236 hypothetical protein ARALYDRAFT_490898 [ 0.732 0.775 0.792 1e-79
356541776228 PREDICTED: CBS domain-containing protein 0.7 0.767 0.805 8e-79
>gi|225438783|ref|XP_002283079.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 181/249 (72%), Positives = 204/249 (81%), Gaps = 8/249 (3%)

Query: 1   MDSIVLPHSISVARLR-APPAGRTSGRTSFALQLPCLLLSRPGCR--VFSVLATSSDRVS 57
           MD+I+LP +++V  +R A  +   SG  SF  Q+PC LL +PG +  V S + + S+R+S
Sbjct: 1   MDAILLPETLAVVGIRPAFASAFGSGSASFPHQMPCTLLFQPGRKPPVGSTVGSRSERIS 60

Query: 58  ALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILV 117
            +RRS A+ A+GTL ANS    +GVYTVGDFMT KE+LHVVK TTTV+EA     LEILV
Sbjct: 61  GIRRSPALAAAGTLMANSVPSKNGVYTVGDFMTRKEDLHVVKATTTVEEA-----LEILV 115

Query: 118 EKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLS 177
           E RITGFPVIDDDWKLVGLVSDYDLLALDSISG G  D  MFPEVDSTWKTFNE+QKLLS
Sbjct: 116 ENRITGFPVIDDDWKLVGLVSDYDLLALDSISGGGLTDTIMFPEVDSTWKTFNELQKLLS 175

Query: 178 KTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRA 237
           KTNGK+VGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD+DGKLVGIITRGNVVRA
Sbjct: 176 KTNGKVVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDSDGKLVGIITRGNVVRA 235

Query: 238 ALQIKHATE 246
           ALQIK A E
Sbjct: 236 ALQIKRAVE 244




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|317106695|dbj|BAJ53196.1| JHL03K20.5 [Jatropha curcas] Back     alignment and taxonomy information
>gi|255587643|ref|XP_002534340.1| conserved hypothetical protein [Ricinus communis] gi|223525462|gb|EEF28042.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147802944|emb|CAN64036.1| hypothetical protein VITISV_021555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224081731|ref|XP_002306482.1| predicted protein [Populus trichocarpa] gi|222855931|gb|EEE93478.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443418|ref|XP_004139474.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525190|ref|XP_004169601.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15234564|ref|NP_195409.1| cystathionine beta-synthase domain-containing protein [Arabidopsis thaliana] gi|75219197|sp|O23193.2|CBSX1_ARATH RecName: Full=CBS domain-containing protein CBSX1, chloroplastic; AltName: Full=CBS domain-containing protein 2; Short=AtCDCP2; AltName: Full=Protein LOSS OF THE TIMING OF ET AND JA BIOSYNTHESIS 2; Short=AtLEJ2; Flags: Precursor gi|4006881|emb|CAB16799.1| putative protein [Arabidopsis thaliana] gi|7270640|emb|CAB80357.1| putative protein [Arabidopsis thaliana] gi|21537376|gb|AAM61717.1| unknown [Arabidopsis thaliana] gi|28392900|gb|AAO41886.1| unknown protein [Arabidopsis thaliana] gi|28827758|gb|AAO50723.1| unknown protein [Arabidopsis thaliana] gi|332661316|gb|AEE86716.1| cystathionine beta-synthase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297802232|ref|XP_002869000.1| hypothetical protein ARALYDRAFT_490898 [Arabidopsis lyrata subsp. lyrata] gi|297314836|gb|EFH45259.1| hypothetical protein ARALYDRAFT_490898 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356541776|ref|XP_003539349.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Glycine max] gi|255632210|gb|ACU16463.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:2114970236 LEJ2 "AT4G36910" [Arabidopsis 0.944 1.0 0.670 1.5e-76
TAIR|locus:2124276238 LEJ1 "AT4G34120" [Arabidopsis 0.784 0.823 0.661 1.2e-65
UNIPROTKB|Q74BN1144 GSU2010 "CBS domain pair-conta 0.28 0.486 0.402 6.8e-11
TIGR_CMR|GSU_2010144 GSU_2010 "CBS domain protein" 0.28 0.486 0.402 6.8e-11
UNIPROTKB|Q3AFN9210 acuB "Acetoin utilization prot 0.228 0.271 0.396 1.7e-09
TIGR_CMR|CHY_0173210 CHY_0173 "acetoin utilization 0.228 0.271 0.396 1.7e-09
UNIPROTKB|Q74C73149 GSU1801 "CBS domain pair-conta 0.56 0.939 0.314 1.6e-08
TIGR_CMR|GSU_1801149 GSU_1801 "CBS domain protein" 0.56 0.939 0.314 1.6e-08
UNIPROTKB|Q3AFS5 271 CHY_0137 "CBS/GGDEF domain pro 0.248 0.228 0.435 3.6e-08
TIGR_CMR|CHY_0137 271 CHY_0137 "CBS/GGDEF domain pro 0.248 0.228 0.435 3.6e-08
TAIR|locus:2114970 LEJ2 "AT4G36910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 771 (276.5 bits), Expect = 1.5e-76, P = 1.5e-76
 Identities = 167/249 (67%), Positives = 191/249 (76%)

Query:     1 MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALR 60
             MD+++    +S   LRA     +S  +S  L LP  L  +P C  F+   +   +     
Sbjct:     1 MDAVLYSVPLSFTPLRA-----SSSPSSPYLLLPRFLSVQP-CHKFTFSRSFPSKSRIPS 54

Query:    61 RSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKR 120
              SSA  A  TL  NS++P SGVYTVG+FMT KE+LHVVKPTTTVDEA     LE+LVE R
Sbjct:    55 ASSA--AGSTLMTNSSSPRSGVYTVGEFMTKKEDLHVVKPTTTVDEA-----LELLVENR 107

Query:   121 ITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTN 180
             ITGFPVID+DWKLVGLVSDYDLLALDSISGSGR +NSMFPEVDSTWKTFN VQKLLSKTN
Sbjct:   108 ITGFPVIDEDWKLVGLVSDYDLLALDSISGSGRTENSMFPEVDSTWKTFNAVQKLLSKTN 167

Query:   181 GKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQ 240
             GK+VGDLMTPAP+VV E TNLEDAA++LLETKYRRLPVVD+DGKLVGIITRGNVVRAALQ
Sbjct:   168 GKLVGDLMTPAPLVVEEKTNLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQ 227

Query:   241 IKHATEMGA 249
             IK + +  A
Sbjct:   228 IKRSGDRNA 236




GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0045454 "cell redox homeostasis" evidence=IDA
TAIR|locus:2124276 LEJ1 "AT4G34120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q74BN1 GSU2010 "CBS domain pair-containing protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2010 GSU_2010 "CBS domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AFN9 acuB "Acetoin utilization protein AcuB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0173 CHY_0173 "acetoin utilization protein AcuB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q74C73 GSU1801 "CBS domain pair-containing protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1801 GSU_1801 "CBS domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AFS5 CHY_0137 "CBS/GGDEF domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0137 CHY_0137 "CBS/GGDEF domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23193CBSX1_ARATHNo assigned EC number0.79780.7320.7754yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019540001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (213 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00023053001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (430 aa)
      0.707
GSVIVG00036526001
RecName- Full=N-acetyl-gamma-glutamyl-phosphate reductase; EC=1.2.1.38; (398 aa)
       0.556
GSVIVG00000640001
RecName- Full=DNA topoisomerase 2; EC=5.99.1.3; (661 aa)
       0.553
GSVIVG00025551001
RecName- Full=Adenylosuccinate synthetase; EC=6.3.4.4;; Plays an important role in the de novo [...] (489 aa)
       0.474

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after 4e-25
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-24
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two 4e-24
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after 7e-22
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after 1e-20
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 2e-20
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 7e-19
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 1e-18
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 1e-18
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after 2e-17
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 6e-17
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 9e-17
pfam0057157 pfam00571, CBS, CBS domain 2e-16
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 2e-16
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 2e-16
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two 1e-15
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 2e-15
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con 6e-14
cd04610107 cd04610, CBS_pair_ParBc_assoc, This cd contains tw 7e-14
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 7e-14
COG2524294 COG2524, COG2524, Predicted transcriptional regula 1e-13
cd04606109 cd04606, CBS_pair_Mg_transporter, This cd contains 2e-13
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 3e-13
cd04643116 cd04643, CBS_pair_30, The CBS domain, named after 4e-13
TIGR01302 450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 5e-13
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after 2e-12
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 3e-12
cd04583109 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai 5e-12
cd04596108 cd04596, CBS_pair_DRTGG_assoc, This cd contains tw 6e-12
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain 9e-12
cd04587113 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd 3e-11
PTZ00314 495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 3e-11
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 4e-11
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after h 4e-11
cd04602114 cd04602, CBS_pair_IMPDH_2, This cd contains two ta 6e-11
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after h 1e-10
COG4109 432 COG4109, COG4109, Predicted transcriptional regula 1e-10
pfam00478 467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 2e-10
pfam0057157 pfam00571, CBS, CBS domain 3e-10
COG3448382 COG3448, COG3448, CBS-domain-containing membrane p 3e-10
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 6e-10
cd04599105 cd04599, CBS_pair_GGDEF_assoc2, This cd contains t 8e-10
cd04635122 cd04635, CBS_pair_22, The CBS domain, named after 2e-09
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after 3e-09
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two 3e-09
COG2239 451 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains 3e-09
cd04642126 cd04642, CBS_pair_29, The CBS domain, named after 3e-09
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent i 6e-09
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 1e-08
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 1e-08
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 1e-08
cd04593115 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con 2e-08
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 3e-08
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con 4e-08
cd04801114 cd04801, CBS_pair_M50_like, This cd contains two t 5e-08
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd c 5e-08
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 6e-08
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co 7e-08
PRK07807 479 PRK07807, PRK07807, inosine 5-monophosphate dehydr 9e-08
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two 1e-07
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 1e-07
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 1e-07
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent i 2e-07
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 3e-07
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 3e-07
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain 4e-07
cd04615113 cd04615, CBS_pair_2, The CBS domain, named after h 4e-07
cd04625112 cd04625, CBS_pair_12, The CBS domain, named after 4e-07
cd04630114 cd04630, CBS_pair_17, The CBS domain, named after 4e-07
cd04641120 cd04641, CBS_pair_28, The CBS domain, named after 7e-07
PLN02274 505 PLN02274, PLN02274, inosine-5'-monophosphate dehyd 1e-06
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-06
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 2e-06
cd04598119 cd04598, CBS_pair_GGDEF_assoc, This cd contains tw 2e-06
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after 3e-06
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 3e-06
cd04609110 cd04609, CBS_pair_PALP_assoc2, This cd contains tw 3e-06
cd04639111 cd04639, CBS_pair_26, The CBS domain, named after 3e-06
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 4e-06
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 4e-06
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after 5e-06
TIGR01303 475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family 5e-06
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 6e-06
cd04597113 cd04597, CBS_pair_DRTGG_assoc2, This cd contains t 7e-06
COG4109 432 COG4109, COG4109, Predicted transcriptional regula 9e-06
COG3620187 COG3620, COG3620, Predicted transcriptional regula 9e-06
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 2e-05
TIGR01302 450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 3e-05
COG3448382 COG3448, COG3448, CBS-domain-containing membrane p 3e-05
cd04594104 cd04594, CBS_pair_EriC_assoc_archaea, This cd cont 3e-05
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 4e-05
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con 6e-05
COG2905 610 COG2905, COG2905, Predicted signal-transduction pr 7e-05
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent i 8e-05
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain 8e-05
cd04643116 cd04643, CBS_pair_30, The CBS domain, named after 9e-05
PRK01862574 PRK01862, PRK01862, putative voltage-gated ClC-typ 9e-05
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after 1e-04
pfam00478 467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 1e-04
PRK07107 502 PRK07107, PRK07107, inosine 5-monophosphate dehydr 1e-04
TIGR01137454 TIGR01137, cysta_beta, cystathionine beta-synthase 1e-04
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con 2e-04
cd04639111 cd04639, CBS_pair_26, The CBS domain, named after 2e-04
COG2905 610 COG2905, COG2905, Predicted signal-transduction pr 2e-04
cd0461496 cd04614, CBS_pair_1, The CBS domain, named after h 2e-04
cd04608124 cd04608, CBS_pair_PALP_assoc, This cd contains two 2e-04
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 2e-04
cd04582106 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contain 2e-04
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 3e-04
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd c 3e-04
cd04591105 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont 3e-04
TIGR00393268 TIGR00393, kpsF, KpsF/GutQ family protein 3e-04
cd04617118 cd04617, CBS_pair_4, The CBS domain, named after h 3e-04
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con 4e-04
cd04602114 cd04602, CBS_pair_IMPDH_2, This cd contains two ta 4e-04
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 4e-04
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 5e-04
cd04615113 cd04615, CBS_pair_2, The CBS domain, named after h 5e-04
PTZ00314 495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 6e-04
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after 9e-04
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after 0.001
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 0.001
cd04593115 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con 0.001
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain 0.001
TIGR01137454 TIGR01137, cysta_beta, cystathionine beta-synthase 0.001
cd04608124 cd04608, CBS_pair_PALP_assoc, This cd contains two 0.001
TIGR00393268 TIGR00393, kpsF, KpsF/GutQ family protein 0.001
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 0.001
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after 0.001
PRK07107 502 PRK07107, PRK07107, inosine 5-monophosphate dehydr 0.002
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after 0.002
cd04596108 cd04596, CBS_pair_DRTGG_assoc, This cd contains tw 0.003
cd04641120 cd04641, CBS_pair_28, The CBS domain, named after 0.003
TIGR00400 449 TIGR00400, mgtE, Mg2+ transporter (mgtE) 0.003
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 0.004
cd0461496 cd04614, CBS_pair_1, The CBS domain, named after h 0.004
>gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
 Score = 95.9 bits (239), Expect = 4e-25
 Identities = 48/126 (38%), Positives = 78/126 (61%), Gaps = 10/126 (7%)

Query: 113 LEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSIS-GSGRADNSMFPEVDSTWKTFNE 171
           +EIL+  +I+G PV+D++ ++VG+VS+ DL+    I  G G             +   ++
Sbjct: 16  VEILLTGKISGVPVVDNEGRVVGIVSEGDLIR--KIYKGKGLFY-VTLLYSV-IFLDESK 71

Query: 172 VQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITR 231
           ++KLL K     V ++MT   + V E T +ED AR++ +   +RLPVVD DGKLVGII+R
Sbjct: 72  IKKLLGKK----VEEIMTKKVITVDEDTTIEDVARIMSKKNIKRLPVVD-DGKLVGIISR 126

Query: 232 GNVVRA 237
           G+++R+
Sbjct: 127 GDIIRS 132


CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 132

>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240014 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|226594 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|225148 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|240114 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239997 cd04625, CBS_pair_12, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|239971 cd04598, CBS_pair_GGDEF_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|239970 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|226594 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|226147 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239967 cd04594, CBS_pair_EriC_assoc_archaea, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|240014 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239987 cd04614, CBS_pair_1, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239981 cd04608, CBS_pair_PALP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|239955 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein Back     alignment and domain information
>gnl|CDD|239989 cd04617, CBS_pair_4, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|239981 cd04608, CBS_pair_PALP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|129495 TIGR00400, mgtE, Mg2+ transporter (mgtE) Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|239987 cd04614, CBS_pair_1, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
COG2524294 Predicted transcriptional regulator, contains C-te 99.81
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.77
COG4109 432 Predicted transcriptional regulator containing CBS 99.73
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.71
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.71
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.71
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.7
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.7
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.7
COG3620187 Predicted transcriptional regulator with C-termina 99.7
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.69
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.69
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.69
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.68
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.68
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.68
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.68
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.68
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.68
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.67
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.67
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.66
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.66
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.66
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.66
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.66
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.65
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.65
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.65
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.65
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.64
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.64
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.64
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.64
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.64
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.64
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.64
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.63
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.63
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.63
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.63
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.63
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.63
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.62
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.62
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.62
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.62
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.62
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.62
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.62
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.62
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.62
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.62
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.62
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.61
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.61
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.61
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.61
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.61
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.61
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.61
PRK11573413 hypothetical protein; Provisional 99.61
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.61
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.61
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.6
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.6
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.6
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.6
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.6
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.59
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.59
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.58
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.58
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.56
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.55
COG2905 610 Predicted signal-transduction protein containing c 99.55
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.55
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.55
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.55
COG1253429 TlyC Hemolysins and related proteins containing CB 99.54
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.54
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.54
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.53
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.52
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.51
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.5
COG0517117 FOG: CBS domain [General function prediction only] 99.48
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.44
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 99.44
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.43
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.34
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.32
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 99.27
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 99.14
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.06
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.05
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 99.01
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 98.95
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 98.9
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 98.64
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 98.62
COG3448382 CBS-domain-containing membrane protein [Signal tra 98.56
COG2524294 Predicted transcriptional regulator, contains C-te 98.52
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.48
PRK14869 546 putative manganese-dependent inorganic pyrophospha 98.45
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 98.44
COG3620187 Predicted transcriptional regulator with C-termina 98.42
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.38
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 98.37
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.33
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 98.33
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 98.3
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 98.29
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 98.26
smart0011649 CBS Domain in cystathionine beta-synthase and othe 98.24
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 98.23
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 98.23
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 98.23
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 98.22
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 98.21
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 98.21
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 98.2
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.19
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 98.19
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 98.19
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 98.18
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 98.18
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 98.18
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 98.16
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 98.16
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 98.16
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 98.14
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 98.13
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 98.13
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 98.12
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 98.12
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 98.12
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 98.12
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 98.11
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 98.11
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.1
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 98.1
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 98.1
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 98.1
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 98.08
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 98.08
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 98.08
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 98.08
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 98.07
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 98.07
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 98.06
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 98.05
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 98.05
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 98.05
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 98.03
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 98.03
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 98.02
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 98.0
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 97.99
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 97.97
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 97.96
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 97.96
PLN02274 505 inosine-5'-monophosphate dehydrogenase 97.96
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 97.95
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.95
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 97.93
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 97.93
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 97.93
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 97.9
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 97.89
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 97.89
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 97.88
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 97.88
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 97.88
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 97.88
COG4175386 ProV ABC-type proline/glycine betaine transport sy 97.87
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.86
COG0517117 FOG: CBS domain [General function prediction only] 97.84
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 97.82
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.82
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 97.81
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.81
cd02205113 CBS_pair The CBS domain, named after human CBS, is 97.81
PRK01862574 putative voltage-gated ClC-type chloride channel C 97.8
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 97.79
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 97.76
KOG0476931 consensus Cl- channel CLC-2 and related proteins ( 97.75
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 97.73
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 97.7
PRK11573413 hypothetical protein; Provisional 97.68
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 97.65
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 97.6
COG2905 610 Predicted signal-transduction protein containing c 97.59
COG1253429 TlyC Hemolysins and related proteins containing CB 97.34
COG4109432 Predicted transcriptional regulator containing CBS 97.33
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 97.25
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 96.89
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 96.87
PRK10070400 glycine betaine transporter ATP-binding subunit; P 96.43
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 95.07
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 94.89
KOG2118 498 consensus Predicted membrane protein, contains two 94.74
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 93.99
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 92.85
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 92.52
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 90.91
COG4175386 ProV ABC-type proline/glycine betaine transport sy 89.48
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 85.33
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 83.78
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
Probab=99.81  E-value=1.8e-19  Score=150.40  Aligned_cols=125  Identities=34%  Similarity=0.487  Sum_probs=113.9

Q ss_pred             CCCCceeccccccCCceeEeCCCCchhcccchhHHHHHHHcCCCeeEEEeCCCcEEEEEehHHHHhhhhccCCCCCCCCC
Q 025613           79 SSGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSM  158 (250)
Q Consensus        79 ~~~~~~v~~~m~~~~~~~~v~~~~~v~~a~~~~~~~~~~~~~~~~~~Vvd~~g~~~GiVt~~dL~~~~~~~~~~~~~~~~  158 (250)
                      .....+++++|.+  +++++.+++|+.++     .+.|.++++.+.||+|++ +++|++|..|+..+.+..         
T Consensus       168 siPk~~V~~~~s~--~~i~v~~d~tl~ea-----ak~f~~~~i~GaPVvd~d-k~vGiit~~dI~~aia~g---------  230 (294)
T COG2524         168 SIPKEKVKNLMSK--KLITVRPDDTLREA-----AKLFYEKGIRGAPVVDDD-KIVGIITLSDIAKAIANG---------  230 (294)
T ss_pred             ecCcchhhhhccC--CceEecCCccHHHH-----HHHHHHcCccCCceecCC-ceEEEEEHHHHHHHHHcC---------
Confidence            4456689999999  99999999999999     999999999999999965 999999999999764322         


Q ss_pred             CCCcccchhchHHHHHHHhccCCCcccccccCCCeEecCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEehHHHHHHH
Q 025613          159 FPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAA  238 (250)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVVd~~g~~vGiIt~~Dil~~l  238 (250)
                                          .....++++|.++++++++|+.+.+|+++|..+++.++.|+|.+|+++|+||+.||+..+
T Consensus       231 --------------------~~~~kV~~~M~k~vitI~eDe~i~dAir~M~~~nVGRLlV~ds~gkpvGiITrTDIL~~i  290 (294)
T COG2524         231 --------------------NLDAKVSDYMRKNVITINEDEDIYDAIRLMNKNNVGRLLVTDSNGKPVGIITRTDILTRI  290 (294)
T ss_pred             --------------------CccccHHHHhccCCceEcCchhHHHHHHHHHhcCcceEEEEccCCcEEEEEehHHHHHHh
Confidence                                246789999999999999999999999999999999999999999999999999999987


Q ss_pred             Hh
Q 025613          239 LQ  240 (250)
Q Consensus       239 ~~  240 (250)
                      ..
T Consensus       291 a~  292 (294)
T COG2524         291 AG  292 (294)
T ss_pred             hc
Confidence            64



>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
4gqv_A166 Crystal Structure Of Cbs-pair Protein, Cbsx1 From A 5e-79
3sl7_A180 Crystal Structure Of Cbs-Pair Protein, Cbsx2 From A 2e-67
4gqw_A152 Crystal Structure Of Cbs-pair Protein, Cbsx1 (loop 4e-67
2cu0_A 486 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 4e-09
2yzq_A 282 Crystal Structure Of Uncharacterized Conserved Prot 9e-09
1vrd_A 494 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 9e-08
3kpb_A122 Crystal Structure Of The Cbs Domain Pair Of Protein 2e-06
3kpc_A124 Crystal Structure Of The Cbs Domain Pair Of Protein 2e-06
3kh5_A280 Crystal Structure Of Protein Mj1225 From Methanocal 4e-06
2yvy_A278 Crystal Structure Of Magnesium Transporter Mgte Cyt 9e-06
2yvx_A 473 Crystal Structure Of Magnesium Transporter Mgte Len 1e-05
2yvz_A278 Crystal Structure Of Magnesium Transporter Mgte Cyt 1e-04
4esy_B170 Crystal Structure Of The Cbs Domain Of Cbs Domain C 3e-04
2o16_A160 Crystal Structure Of A Putative Acetoin Utilization 4e-04
4esy_A170 Crystal Structure Of The Cbs Domain Of Cbs Domain C 5e-04
2p9m_A138 Crystal Structure Of Conserved Hypothetical Protein 6e-04
>pdb|4GQV|A Chain A, Crystal Structure Of Cbs-pair Protein, Cbsx1 From Arabidopsis Thaliana Length = 166 Back     alignment and structure

Iteration: 1

Score = 290 bits (743), Expect = 5e-79, Method: Compositional matrix adjust. Identities = 143/170 (84%), Positives = 155/170 (91%), Gaps = 5/170 (2%) Query: 80 SGVYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSD 139 SGVYTVG+FMT KE+LHVVKPTTTVDEA LE+LVE RITGFPVID+DWKLVGLVSD Sbjct: 2 SGVYTVGEFMTKKEDLHVVKPTTTVDEA-----LELLVENRITGFPVIDEDWKLVGLVSD 56 Query: 140 YDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETT 199 YDLLALDSISGSGR +NSMFPEVDSTWKTFN VQKLLSKTNGK+VGDLMTPAP+VV E T Sbjct: 57 YDLLALDSISGSGRTENSMFPEVDSTWKTFNAVQKLLSKTNGKLVGDLMTPAPLVVEEKT 116 Query: 200 NLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATEMGA 249 NLEDAA++LLETKYRRLPVVD+DGKLVGIITRGNVVRAALQIK + + A Sbjct: 117 NLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIKRSGDRNA 166
>pdb|3SL7|A Chain A, Crystal Structure Of Cbs-Pair Protein, Cbsx2 From Arabidopsis Thaliana Length = 180 Back     alignment and structure
>pdb|4GQW|A Chain A, Crystal Structure Of Cbs-pair Protein, Cbsx1 (loop Deletion) From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|2CU0|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 486 Back     alignment and structure
>pdb|2YZQ|A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Pyrococcus Horikoshii Length = 282 Back     alignment and structure
>pdb|1VRD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase (Tm1347) From Thermotoga Maritima At 2.18 A Resolution Length = 494 Back     alignment and structure
>pdb|3KPB|A Chain A, Crystal Structure Of The Cbs Domain Pair Of Protein Mj0100 In Complex With 5 -Methylthioadenosine And S-Adenosyl-L- Methionine. Length = 122 Back     alignment and structure
>pdb|3KPC|A Chain A, Crystal Structure Of The Cbs Domain Pair Of Protein Mj0100 In Complex With 5 -Methylthioadenosine And S-Adenosyl-L- Methionine Length = 124 Back     alignment and structure
>pdb|3KH5|A Chain A, Crystal Structure Of Protein Mj1225 From Methanocaldococcus Jannaschii, A Putative Archaeal Homolog Of G-Ampk. Length = 280 Back     alignment and structure
>pdb|2YVY|A Chain A, Crystal Structure Of Magnesium Transporter Mgte Cytosolic Domain, Mg2+ Bound Form Length = 278 Back     alignment and structure
>pdb|2YVX|A Chain A, Crystal Structure Of Magnesium Transporter Mgte Length = 473 Back     alignment and structure
>pdb|2YVZ|A Chain A, Crystal Structure Of Magnesium Transporter Mgte Cytosolic Domain, Mg2+-Free Form Length = 278 Back     alignment and structure
>pdb|4ESY|B Chain B, Crystal Structure Of The Cbs Domain Of Cbs Domain Containing Membrane Protein From Sphaerobacter Thermophilus Length = 170 Back     alignment and structure
>pdb|2O16|A Chain A, Crystal Structure Of A Putative Acetoin Utilization Protein (Acub) From Vibrio Cholerae Length = 160 Back     alignment and structure
>pdb|4ESY|A Chain A, Crystal Structure Of The Cbs Domain Of Cbs Domain Containing Membrane Protein From Sphaerobacter Thermophilus Length = 170 Back     alignment and structure
>pdb|2P9M|A Chain A, Crystal Structure Of Conserved Hypothetical Protein Mj0922 From Methanocaldococcus Jannaschii Dsm 2661 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 4e-60
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 4e-14
1o50_A157 CBS domain-containing predicted protein TM0935; CB 4e-46
1o50_A157 CBS domain-containing predicted protein TM0935; CB 2e-17
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 7e-39
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 5e-16
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 3e-38
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 4e-15
3lqn_A150 CBS domain protein; csgid, structural genomics, un 7e-38
3lqn_A150 CBS domain protein; csgid, structural genomics, un 4e-16
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 1e-37
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 8e-16
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 2e-35
2o16_A160 Acetoin utilization protein ACUB, putative; struct 2e-35
2o16_A160 Acetoin utilization protein ACUB, putative; struct 2e-15
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 2e-34
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 2e-33
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 3e-15
1pvm_A184 Conserved hypothetical protein TA0289; structural 2e-32
1pvm_A 184 Conserved hypothetical protein TA0289; structural 4e-14
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 2e-32
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 3e-31
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 6e-16
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 1e-09
1pbj_A125 Hypothetical protein; structural genomics, domain, 7e-31
1vr9_A213 CBS domain protein/ACT domain protein; structural 9e-31
1vr9_A213 CBS domain protein/ACT domain protein; structural 7e-10
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 3e-30
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 4e-30
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 4e-29
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 4e-26
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 1e-11
3ddj_A296 CBS domain-containing protein; structural genomics 4e-28
3ddj_A 296 CBS domain-containing protein; structural genomics 7e-26
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 9e-28
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 3e-24
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 1e-27
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 5e-27
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 6e-14
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 1e-13
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 5e-27
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 2e-16
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 5e-26
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 2e-25
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 3e-24
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 3e-22
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 9e-22
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 3e-12
4fry_A157 Putative signal-transduction protein with CBS DOM; 3e-24
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 4e-24
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 8e-08
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 1e-22
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 2e-10
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 6e-21
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 5e-19
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 4e-11
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 1e-06
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 2e-16
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 9e-05
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 1e-15
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 1e-06
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 8e-05
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 3e-15
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 1e-06
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 5e-05
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 3e-15
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 9e-07
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 8e-15
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 5e-07
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 3e-14
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 5e-05
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 4e-14
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 5e-05
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 3e-13
3kxr_A205 Magnesium transporter, putative; cystathionine bet 2e-11
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 4e-11
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 5e-11
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 9e-11
2oux_A286 Magnesium transporter; 10001B, structural genomics 3e-10
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 3e-10
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 7e-10
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 6e-08
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 2e-06
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-05
3fio_A70 A cystathionine beta-synthase domain protein fused 9e-05
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 4e-04
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 7e-04
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
 Score =  186 bits (475), Expect = 4e-60
 Identities = 122/164 (74%), Positives = 147/164 (89%), Gaps = 5/164 (3%)

Query: 83  YTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDL 142
           YTVGDFMT ++ LHVVKP+T+VD+A     LE+LVEK++TG PVIDD+W LVG+VSDYDL
Sbjct: 4   YTVGDFMTPRQNLHVVKPSTSVDDA-----LELLVEKKVTGLPVIDDNWTLVGVVSDYDL 58

Query: 143 LALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLE 202
           LALDSISG  + D ++FP+VDSTWKTFNE+QKL+SKT GK+VGDLMTP+P+VVR++TNLE
Sbjct: 59  LALDSISGRSQNDTNLFPDVDSTWKTFNELQKLISKTYGKVVGDLMTPSPLVVRDSTNLE 118

Query: 203 DAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKHATE 246
           DAARLLLETK+RRLPVVDADGKL+GI+TRGNVVRAALQIK   +
Sbjct: 119 DAARLLLETKFRRLPVVDADGKLIGILTRGNVVRAALQIKRNAD 162


>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Length = 205 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Length = 278 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Length = 473 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Length = 286 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.91
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.89
4esy_A170 CBS domain containing membrane protein; structural 99.89
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.88
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.88
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.88
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.88
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.87
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.87
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.87
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.87
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.87
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.87
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.86
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.86
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.86
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.86
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.85
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.85
3ocm_A173 Putative membrane protein; structural genomics, PS 99.85
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.85
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.85
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.84
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.84
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.84
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.84
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.84
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.84
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.83
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.83
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.83
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.83
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.83
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.82
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.82
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.82
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.81
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.81
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.81
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.81
3ddj_A296 CBS domain-containing protein; structural genomics 99.8
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.79
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.79
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.78
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.78
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.78
3ddj_A296 CBS domain-containing protein; structural genomics 99.77
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.76
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.76
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.74
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.73
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.73
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.72
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.72
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.71
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.71
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.66
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.65
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 99.64
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.63
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.63
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.63
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.62
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.61
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.58
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.57
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.51
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.42
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.27
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 99.22
4esy_A170 CBS domain containing membrane protein; structural 99.03
3fio_A70 A cystathionine beta-synthase domain protein fused 98.99
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 98.84
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 98.83
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.82
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.81
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 98.8
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 98.79
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 98.79
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.79
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 98.78
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.77
4fry_A157 Putative signal-transduction protein with CBS DOM; 98.76
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 98.76
2o16_A160 Acetoin utilization protein ACUB, putative; struct 98.74
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 98.73
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 98.73
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 98.72
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 98.72
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 98.71
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 98.7
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 98.7
1pbj_A125 Hypothetical protein; structural genomics, domain, 98.69
3fio_A70 A cystathionine beta-synthase domain protein fused 98.69
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 98.68
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.66
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 98.65
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 98.65
3kxr_A205 Magnesium transporter, putative; cystathionine bet 98.65
3lqn_A150 CBS domain protein; csgid, structural genomics, un 98.64
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 98.64
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 98.63
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 98.63
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 98.63
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 98.63
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 98.62
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 98.61
3ocm_A173 Putative membrane protein; structural genomics, PS 98.59
1pvm_A 184 Conserved hypothetical protein TA0289; structural 98.59
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 98.58
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 98.58
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 98.57
3oco_A153 Hemolysin-like protein containing CBS domains; str 98.55
1o50_A157 CBS domain-containing predicted protein TM0935; CB 98.53
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 98.51
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 98.48
2oux_A286 Magnesium transporter; 10001B, structural genomics 98.44
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 98.41
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 98.37
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 98.16
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 98.09
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.04
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 98.04
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.0
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.9
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 97.87
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.77
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.57
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
Probab=99.91  E-value=2.7e-24  Score=172.96  Aligned_cols=159  Identities=77%  Similarity=1.218  Sum_probs=129.5

Q ss_pred             CceeccccccCCceeEeCCCCchhcccchhHHHHHHHcCCCeeEEEeCCCcEEEEEehHHHHhhhhccCCCCCCCCCCCC
Q 025613           82 VYTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPE  161 (250)
Q Consensus        82 ~~~v~~~m~~~~~~~~v~~~~~v~~a~~~~~~~~~~~~~~~~~~Vvd~~g~~~GiVt~~dL~~~~~~~~~~~~~~~~~~~  161 (250)
                      .++++++|++..+++++.+++++.+|     ++.|.+++++++||+|++|+++|+|+..||+++....+........++.
T Consensus         3 ~~~v~dim~~~~~~~~v~~~~~l~~a-----~~~m~~~~~~~~pVvd~~~~~~Givt~~dl~~~~~~~~~~~~~~~~~~~   77 (180)
T 3sl7_A            3 GYTVGDFMTPRQNLHVVKPSTSVDDA-----LELLVEKKVTGLPVIDDNWTLVGVVSDYDLLALDSISGRSQNDTNLFPD   77 (180)
T ss_dssp             CCBHHHHSEEGGGCCCBCTTSBHHHH-----HHHHHHHTCSEEEEECTTCBEEEEEEHHHHTCC----------------
T ss_pred             ceeHHHhcCCCCCceeeCCCCcHHHH-----HHHHHHcCCCeEEEECCCCeEEEEEEHHHHHhhhhhccccCCccccccc
Confidence            46899999876568999999999999     9999999999999999999999999999999765544444445556667


Q ss_pred             cccchhchHHHHHHHhccCCCcccccccCCCeEecCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEehHHHHHHHHhh
Q 025613          162 VDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQI  241 (250)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVVd~~g~~vGiIt~~Dil~~l~~~  241 (250)
                      ..+.|..|.+...........++.++|.++++++++++++.+|+++|.+++++++||+|++|+++|+||++||++++.+.
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~v~~~m~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~~vGiit~~dil~~~~~~  157 (180)
T 3sl7_A           78 VDSTWKTFNELQKLISKTYGKVVGDLMTPSPLVVRDSTNLEDAARLLLETKFRRLPVVDADGKLIGILTRGNVVRAALQI  157 (180)
T ss_dssp             ---CCCSHHHHHHHHHTTTTCBHHHHSEESCCCEETTSBHHHHHHHHTTSTTCEEEEECTTCBEEEEEEHHHHHHHHHHH
T ss_pred             ccchhhhhHHHHHHHhccccccHHHHhCCCceEeCCCCcHHHHHHHHHHcCCCEEEEECCCCeEEEEEEHHHHHHHHHHH
Confidence            78889999888887777778899999999999999999999999999999999999999899999999999999999887


Q ss_pred             hhhh
Q 025613          242 KHAT  245 (250)
Q Consensus       242 ~~~~  245 (250)
                      .+..
T Consensus       158 ~~~~  161 (180)
T 3sl7_A          158 KRNA  161 (180)
T ss_dssp             HHTC
T ss_pred             hhhh
Confidence            7654



>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 5e-21
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 1e-19
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 2e-19
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 0.001
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 1e-18
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 4e-18
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 2e-07
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 6e-18
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 7e-18
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 2e-17
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 3e-16
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 0.003
d3ddja2135 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 3e-15
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 6e-15
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 3e-06
d3ddja1141 d.37.1.1 (A:136-276) Uncharacterized protein SSO32 1e-14
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 1e-14
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 1e-14
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 3e-06
d2ouxa2127 d.37.1.1 (A:136-262) Magnesium transporter MgtE {E 4e-14
d2ouxa2127 d.37.1.1 (A:136-262) Magnesium transporter MgtE {E 0.001
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 1e-13
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 9e-06
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 3e-04
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 2e-13
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 1e-06
d1pbja3120 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A 2e-13
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 5e-13
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 3e-06
d2ooxe2153 d.37.1.1 (E:182-334) Uncharacterized protein C1556 1e-12
d2yvxa2144 d.37.1.1 (A:132-275) Magnesium transporter MgtE {T 2e-12
d2yvxa2144 d.37.1.1 (A:132-275) Magnesium transporter MgtE {T 7e-05
d2yzqa2122 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 3e-12
d1yava3132 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac 9e-12
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 2e-11
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 1e-05
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 2e-04
d1zfja4126 d.37.1.1 (A:95-220) Type II inosine monophosphate 5e-11
d1zfja4126 d.37.1.1 (A:95-220) Type II inosine monophosphate 0.002
d2riha1131 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 5e-10
d1lkvx_213 a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 1e-05
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Uncharacterized protein PH1780
species: Pyrococcus horikoshii [TaxId: 53953]
 Score = 84.3 bits (207), Expect = 5e-21
 Identities = 30/159 (18%), Positives = 64/159 (40%), Gaps = 10/159 (6%)

Query: 84  TVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLL 143
            +  +      + +V   T +  A     L+ L+       PV+D +  LVG+V + DLL
Sbjct: 5   EIEPYYQR--YVSIVWEGTPLKAA-----LKALLLSNSMALPVVDSEGNLVGIVDETDLL 57

Query: 144 ALDSISGSGRADNSMFPEVDSTWKTFNE---VQKLLSKTNGKMVGDLMTPAPVVVRETTN 200
               I    ++        +      +     +K   +   K V ++MT   +V      
Sbjct: 58  RDSEIVRIMKSTELAASSEEEWILESHPTLLFEKFELQLPNKPVAEIMTRDVIVATPHMT 117

Query: 201 LEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAAL 239
           + + A  + +    +LPV+  +G L+G+I   ++++  +
Sbjct: 118 VHEVALKMAKYSIEQLPVIRGEGDLIGLIRDFDLLKVLV 156


>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.89
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.89
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.89
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.89
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.89
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.89
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.88
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.88
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.88
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.87
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.87
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.87
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.86
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.86
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.86
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.84
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.84
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.83
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.82
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.82
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.82
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.8
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.79
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.79
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.77
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.77
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.06
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 98.98
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 98.96
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.96
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 98.96
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 98.95
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 98.93
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 98.92
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.91
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 98.9
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 98.89
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 98.87
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.81
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 98.81
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.8
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.79
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 98.75
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 98.7
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 98.68
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 98.66
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 98.63
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 98.62
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 98.6
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 98.4
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.36
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 98.34
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 90.69
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein VC0737
species: Vibrio cholerae [TaxId: 666]
Probab=99.89  E-value=2.5e-23  Score=160.17  Aligned_cols=136  Identities=29%  Similarity=0.342  Sum_probs=115.6

Q ss_pred             ceeccccccCCceeEeCCCCchhcccchhHHHHHHHcCCCeeEEEeCCCcEEEEEehHHHHhhhhccCCCCCCCCCCCCc
Q 025613           83 YTVGDFMTTKEELHVVKPTTTVDEAFVPTALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEV  162 (250)
Q Consensus        83 ~~v~~~m~~~~~~~~v~~~~~v~~a~~~~~~~~~~~~~~~~~~Vvd~~g~~~GiVt~~dL~~~~~~~~~~~~~~~~~~~~  162 (250)
                      ++++|+|++  ++.++.+++++.+|     ++.|.+++++++||+|++|+++|+||..||+++........         
T Consensus         2 i~v~diM~~--~~~~v~~~~tl~~a-----~~~m~~~~~~~lpVvd~~~~~~Giit~~dl~~~~~~~~~~~---------   65 (139)
T d2o16a3           2 IKVEDMMTR--HPHTLLRTHTLNDA-----KHLMEALDIRHVPIVDANKKLLGIVSQRDLLAAQESSLQRS---------   65 (139)
T ss_dssp             CBGGGTSEE--SCCCBCTTSBHHHH-----HHHHHHHTCSEEEEECTTCBEEEEEEHHHHHHHHHHHCC-----------
T ss_pred             EEHHHhCcC--CCeEECCcCCHHHH-----HHHHHHcCCCeeeeecccccccccccHHHHHHHHHhhhhhh---------
Confidence            579999998  89999999999999     99999999999999999999999999999997643221100         


Q ss_pred             ccchhchHHHHHHHhccCCCcccccccCCCeEecCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEehHHHHHHHHhhh
Q 025613          163 DSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIK  242 (250)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVVd~~g~~vGiIt~~Dil~~l~~~~  242 (250)
                                ..........++.++|.++++++++++++.+|+++|.+++++++||+| +|+++|+||+.||++++.+..
T Consensus        66 ----------~~~~~~~~~~~v~~im~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd-~~~lvGiit~~Dil~~~~~~~  134 (139)
T d2o16a3          66 ----------AQGDSLAFETPLFEVMHTDVTSVAPQAGLKESAIYMQKHKIGCLPVVA-KDVLVGIITDSDFVTIAINLL  134 (139)
T ss_dssp             -----------------CCCBHHHHSCSCEEEBCTTSBHHHHHHHHHHTTCSCEEEEE-TTEEEEEECHHHHHHHHHHHH
T ss_pred             ----------hcccccccccchhHhhccccccccccchHHHHHHHHHHcCceEEEEEE-CCEEEEEEEHHHHHHHHHHHH
Confidence                      000012346789999999999999999999999999999999999999 689999999999999999887


Q ss_pred             hhh
Q 025613          243 HAT  245 (250)
Q Consensus       243 ~~~  245 (250)
                      +..
T Consensus       135 ~~~  137 (139)
T d2o16a3         135 ELQ  137 (139)
T ss_dssp             HHH
T ss_pred             hhc
Confidence            654



>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure