Citrus Sinensis ID: 025658

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MAGAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMCI
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHcccccccEEEEEEccEEEccccccccccHHHHHHHHHHHHHHHccccEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHccEEEEccccccccccccccccccccccccccccccccHHHHHHcccccc
ccccccEEEccccccEEEHcccccccccccccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHHccccccEEEEEEEccEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccEEEEcccccccccccccccHHHccccccccccHHHHHHHHccccEccc
MAGAVKRIKLGSQGLEVSAQglgcmgmsafygppkpesdMIALIHHAINSGitlldtsdiygphtnEILLGKALKGGMRERVELATKFGisfadgkreirgdpaYVRAACEASLKRLDIDCIDLYYqhridtrvpIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELgigivaysplgrgffssgpklvesfskeDFRQVCKSTKQLLAFGMNYMCI
magavkriklgsqgLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATkfgisfadgkreirgdpAYVRAACEASLKRLDIDCIDLYYqhridtrvpieVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLlafgmnymci
MAGAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMCI
****************VSAQGLGCMGMSAFYGP****SDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMC*
*****KR*KLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMCI
MAGAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMCI
****VKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMCI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQVCKSTKQLLAFGMNYMCI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
P40691307 Auxin-induced protein PCN N/A no 0.911 0.739 0.870 1e-117
P49249306 IN2-2 protein OS=Zea mays N/A no 0.915 0.745 0.859 1e-116
Q93ZN2345 Probable aldo-keto reduct yes no 0.923 0.666 0.852 1e-116
Q7XT99351 Probable aldo-keto reduct yes no 0.911 0.646 0.850 1e-116
A2XRZ0351 Probable aldo-keto reduct N/A no 0.911 0.646 0.850 1e-115
O22707345 Probable aldo-keto reduct no no 0.939 0.678 0.811 1e-113
Q9ASZ9345 Probable aldo-keto reduct no no 0.951 0.686 0.797 1e-111
Q9C5B9344 Probable aldo-keto reduct no no 0.923 0.668 0.804 1e-106
Q84M96346 Probable aldo-keto reduct no no 0.939 0.676 0.765 1e-106
Q0JE32350 Probable aldo-keto reduct no no 0.907 0.645 0.797 1e-105
>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function desciption
 Score =  419 bits (1077), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/232 (87%), Positives = 212/232 (91%), Gaps = 5/232 (2%)

Query: 5   VKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPH 64
           V RIKLGSQGLEVSAQGLGCMGMSAFYGPPKPE DMI LIHHAINSGITLLDTSD+YGPH
Sbjct: 8   VPRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIQLIHHAINSGITLLDTSDVYGPH 67

Query: 65  TNEILLGKALKGGMRERVELATKFGISFAD-----GKREIRGDPAYVRAACEASLKRLDI 119
           TNEILLGKALKGG RERV LATKFGI   D     GKR + GDPAYVRAACEASLKRLDI
Sbjct: 68  TNEILLGKALKGGTRERVVLATKFGIVLGDEKKAEGKRAVHGDPAYVRAACEASLKRLDI 127

Query: 120 DCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQL 179
           DCIDLYYQHR+DTRVPIE+T+GELKKLVEEGK+KYIGLSEASASTIRRAHAVHPITAVQL
Sbjct: 128 DCIDLYYQHRVDTRVPIEITVGELKKLVEEGKLKYIGLSEASASTIRRAHAVHPITAVQL 187

Query: 180 EWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQ 231
           EWSLWSRDVE EI+PTCRELGIGIVAYSPLGRGF SSGPKL+E  S ED+R+
Sbjct: 188 EWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMSNEDYRK 239

Nicotiana tabacum (taxid: 4097)
>sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description
>sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5B9|AKR1_ARATH Probable aldo-keto reductase 1 OS=Arabidopsis thaliana GN=At1g10810 PE=2 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|Q0JE32|AKR1_ORYSJ Probable aldo-keto reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0337500 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
118487572345 unknown [Populus trichocarpa] 0.927 0.669 0.892 1e-120
224131488343 predicted protein [Populus trichocarpa] 0.923 0.670 0.896 1e-120
449468806342 PREDICTED: probable aldo-keto reductase 0.927 0.675 0.900 1e-119
62526573344 aldo/keto reductase AKR [Manihot esculen 0.927 0.671 0.892 1e-119
147767361341 hypothetical protein VITISV_040294 [Viti 0.919 0.671 0.895 1e-119
225433674341 PREDICTED: auxin-induced protein PCNT115 0.919 0.671 0.890 1e-119
449484655342 PREDICTED: probable aldo-keto reductase 0.927 0.675 0.900 1e-118
224069573343 predicted protein [Populus trichocarpa] 0.919 0.667 0.891 1e-118
255591425256 aldo/keto reductase, putative [Ricinus c 0.911 0.886 0.889 1e-117
226495965346 uncharacterized protein LOC100273138 [Ze 0.915 0.658 0.864 1e-115
>gi|118487572|gb|ABK95612.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/233 (89%), Positives = 224/233 (96%), Gaps = 2/233 (0%)

Query: 1   MAGAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDI 60
           MA AVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDM++LIHHAIN+G+TLLDTSD+
Sbjct: 1   MAAAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMVSLIHHAINTGVTLLDTSDM 60

Query: 61  YGPHTNEILLGKALKGG--MRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLD 118
           YGPHTNEILLGKALK G  +RE+VELATKFGI+F DGKREIRGDPAYVRAACEASLKRL 
Sbjct: 61  YGPHTNEILLGKALKAGSGLREKVELATKFGINFQDGKREIRGDPAYVRAACEASLKRLQ 120

Query: 119 IDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQ 178
           +DC+DLYYQHRIDT+VPIEVT+GELKKLVEEGKIKYIGLSEASASTIRRAHAVHP+TAVQ
Sbjct: 121 LDCVDLYYQHRIDTKVPIEVTMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQ 180

Query: 179 LEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQ 231
           LEWSLWSRDVE EIVPTCRELGIGIVAYSPLGRGF SSGPKLVESF++ DFR+
Sbjct: 181 LEWSLWSRDVEEEIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESFTEGDFRK 233

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224131488|ref|XP_002321097.1| predicted protein [Populus trichocarpa] gi|222861870|gb|EEE99412.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449468806|ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] Back     alignment and taxonomy information
>gi|147767361|emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225433674|ref|XP_002266027.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449484655|ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224069573|ref|XP_002303002.1| predicted protein [Populus trichocarpa] gi|222844728|gb|EEE82275.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255591425|ref|XP_002535506.1| aldo/keto reductase, putative [Ricinus communis] gi|223522847|gb|EEF26877.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|226495965|ref|NP_001141057.1| uncharacterized protein LOC100273138 [Zea mays] gi|194702442|gb|ACF85305.1| unknown [Zea mays] gi|414869723|tpg|DAA48280.1| TPA: putative oxidoreductase, aldo/keto reductase family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2036504345 ATB2 [Arabidopsis thaliana (ta 0.923 0.666 0.852 6.5e-106
TAIR|locus:2036611345 AT1G60690 "AT1G60690" [Arabido 0.939 0.678 0.811 6.9e-102
TAIR|locus:2196446344 AT1G10810 "AT1G10810" [Arabido 0.923 0.668 0.804 8.4e-97
TAIR|locus:2036591346 AT1G60680 "AT1G60680" [Arabido 0.939 0.676 0.765 5.9e-96
TAIR|locus:2036551330 AT1G60750 [Arabidopsis thalian 0.839 0.633 0.809 4e-90
TIGR_CMR|SPO_A0345327 SPO_A0345 "oxidoreductase, ald 0.887 0.675 0.557 3.5e-59
TIGR_CMR|GSU_3126334 GSU_3126 "oxidoreductase, aldo 0.895 0.667 0.521 4.6e-57
POMBASE|SPAC1F7.12340 yak3 "aldose reductase ARK13 f 0.883 0.647 0.471 2.6e-47
ASPGD|ASPL0000072041351 AN8733 [Emericella nidulans (t 0.879 0.623 0.434 1.7e-43
ASPGD|ASPL0000051701339 AN10217 [Emericella nidulans ( 0.871 0.640 0.442 4.5e-43
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1048 (374.0 bits), Expect = 6.5e-106, P = 6.5e-106
 Identities = 196/230 (85%), Positives = 219/230 (95%)

Query:     2 AGAVKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIY 61
             A  V+R+KLGSQGLEVSAQGLGCMG+SAFYG PKPE++ IALIHHAI+SG+TLLDTSDIY
Sbjct:     4 ACGVRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIY 63

Query:    62 GPHTNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDC 121
             GP TNE+LLGKALK G+RE+VELATKFGIS+A+GKRE+RGDP YVRAACEASLKRLDI C
Sbjct:    64 GPETNEVLLGKALKDGVREKVELATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIAC 123

Query:   122 IDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEW 181
             IDLYYQHR+DTRVPIE+T+GELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQ+EW
Sbjct:   124 IDLYYQHRVDTRVPIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEW 183

Query:   182 SLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQ 231
             SLW+RDVE EI+PTCRELGIGIVAYSPLGRGFF+SGPKLVE+  K+DFR+
Sbjct:   184 SLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRK 233
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40691A115_TOBACNo assigned EC number0.87060.91160.7394N/Ano
P49249IN22_MAIZENo assigned EC number0.85960.91560.7450N/Ano
Q7XT99AKR2_ORYSJ1, ., 1, ., 1, ., -0.85020.91160.6467yesno
B8ASB2AKR1_ORYSI1, ., 1, ., 1, ., -0.79730.90760.6457N/Ano
A2XRZ6AKR3_ORYSI1, ., 1, ., 1, ., -0.73590.89950.6309N/Ano
A2XRZ0AKR2_ORYSI1, ., 1, ., 1, ., -0.85020.91160.6467N/Ano
Q93ZN2ALKR4_ARATH1, ., 1, ., 1, ., -0.85210.92360.6666yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 4e-82
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 1e-80
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 2e-66
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-34
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 6e-26
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 2e-22
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 6e-22
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 2e-20
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 2e-20
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 4e-19
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-17
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 4e-08
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 2e-05
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  247 bits (632), Expect = 4e-82
 Identities = 92/230 (40%), Positives = 125/230 (54%), Gaps = 10/230 (4%)

Query: 7   RIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTN 66
              LG  GL+VS  GLG   +    G    E +  A +  A+++GI  +DT+D+YG   +
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLG---GGYVDEEEAAAAVRAALDAGINFIDTADVYGDGES 57

Query: 67  EILLGKALKG-GMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLY 125
           E LLG+ALK  G RE V +ATK G    DG+      P ++R A E SLKRL  D IDLY
Sbjct: 58  EELLGEALKERGPREEVFIATKVGPRPGDGRD---LSPEHIRRAVEESLKRLGTDYIDLY 114

Query: 126 YQHRIDTRVP-IEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAV--HPITAVQLEWS 182
             H  D   P IE T+  L++LV+EGKI+ IG+S  SA  +  A A    P    Q+E++
Sbjct: 115 LLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVEYN 174

Query: 183 LWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQV 232
           L  R  E E++P CRE GIG++AYSPL  G  +          + D  + 
Sbjct: 175 LLDRQAEEELLPYCREHGIGVIAYSPLAGGLLTGKYLPGAPPPEGDLLEA 224

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
PLN02587314 L-galactose dehydrogenase 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.47
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 94.96
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 92.28
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 90.59
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 90.43
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 88.88
PRK13796 365 GTPase YqeH; Provisional 88.87
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 84.98
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 84.11
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 82.83
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 82.37
PRK08609570 hypothetical protein; Provisional 81.95
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 80.59
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 80.56
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-54  Score=374.97  Aligned_cols=215  Identities=44%  Similarity=0.678  Sum_probs=196.8

Q ss_pred             CcceecCCCCcccCcceecccccCCCCCCCCCHHHHHHHHHHHHhcCCCEEeCcCCcCCChHHHHHHHHhcCCC-CCCeE
Q 025658            5 VKRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGM-RERVE   83 (249)
Q Consensus         5 ~~~~~lg~~g~~vs~lglG~~~~g~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~se~~lg~~l~~~~-r~~~~   83 (249)
                      |++++||++|++||+||||||.+|+.+ ...+.+++.++|++|+++||||||||+.||.|.||+++|++|+..+ |++++
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~~-~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vv   79 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGDT-DDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVV   79 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCCC-CchhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEE
Confidence            788999999999999999999998642 2334557888999999999999999999999999999999999844 89999


Q ss_pred             EEeecCcccCC-CCC-cCCCCHHHHHHHHHHHHHHcCCCccceEEeecCCCCCCHHHHHHHHHHHHHcCcccEEEcCccc
Q 025658           84 LATKFGISFAD-GKR-EIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  161 (249)
Q Consensus        84 i~tK~~~~~~~-~~~-~~~~~~~~i~~~~~~sL~rLg~~~lDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~  161 (249)
                      |+||++....+ ... ..+.++++|+++++.||+|||+||||+|++||||...+.++++++|.+|+++|+||+||+||++
T Consensus        80 IaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~~  159 (316)
T COG0667          80 IATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYS  159 (316)
T ss_pred             EEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCCC
Confidence            99999977642 212 2567999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhc-CCeeEEeeccCccCcCchhhHHHHHHHcCCeEEEcccCccccCCCCCCC
Q 025658          162 ASTIRRAHAV-HPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKL  220 (249)
Q Consensus       162 ~~~l~~~~~~-~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~v~a~spl~~G~l~~~~~~  220 (249)
                      ++++.++++. .+++++|.+||++++..+.+++++|+++||++++||||++|+|++++..
T Consensus       160 ~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G~Ltgk~~~  219 (316)
T COG0667         160 AEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLTGKYLP  219 (316)
T ss_pred             HHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEEecCccccccCCCcCC
Confidence            9999999998 6999999999999988787899999999999999999999999999876

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
3v0t_A337 Crystal Structure Of Perakine Reductase, Founder Me 2e-75
3v0u_A338 Crystal Structure Of Perakine Reductase, Founder Me 2e-75
3uyi_A337 Crystal Structure Of Perakine Reductase, Founder Me 5e-75
3v0s_A337 Crystal Structure Of Perakine Reductase, Founder Me 9e-73
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 2e-27
1pz1_A333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 2e-24
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 3e-24
3n2t_A348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 6e-23
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 1e-19
3eb3_A327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 5e-17
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 1e-16
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 1e-16
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 1e-16
3eau_A327 Voltage-Dependent K+ Channel Beta Subunit In Comple 2e-16
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 2e-16
1exb_A332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 2e-16
2a79_A333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 2e-16
3lut_A367 A Structural Model For The Full-Length Shaker Potas 2e-16
3eb4_A327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 2e-16
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 3e-15
1gve_A327 Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live 5e-13
2bp1_B360 Structure Of The Aflatoxin Aldehyde Reductase In Co 5e-13
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 5e-12
2c91_A338 Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt 6e-12
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 2e-11
2clp_A347 Crystal Structure Of Human Aflatoxin B1 Aldehyde Re 4e-11
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 4e-11
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 5e-09
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 8e-09
4exa_A292 Crystal Structure Of The Pa4992, The Putative Aldo- 1e-08
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 6e-08
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 1e-07
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 2e-07
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 1e-06
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 1e-06
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 1e-06
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 1e-06
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 1e-06
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 2e-06
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 3e-06
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 4e-06
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 5e-06
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 6e-06
2alr_A324 Aldehyde Reductase Length = 324 9e-06
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 9e-06
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 1e-05
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 2e-05
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 5e-05
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 7e-05
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 1e-04
3b3d_A314 B.Subtilis Ytbe Length = 314 1e-04
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 1e-04
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 1e-04
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 1e-04
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 3e-04
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 3e-04
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 4e-04
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 7e-04
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 7e-04
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 7e-04
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure 
Iteration: 1

 Score =  278 bits (712), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 166/212 (78%), Gaps = 6/212 (2%)
Query: 7   RIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPH-T 65
           R+KLG+QGLEVS  G GCMG+S  Y    PE   IA+I  A N GIT  DTSDIYG + +
Sbjct: 3   RVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGS 62
Query: 66  NEILLGKALKGGMRERVELATKFGI---SFADGKREIRGDPAYVRAACEASLKRLDIDCI 122
           NE LLGKALK   RE++++ TKFGI    F+  K   +G P YVR+ CEASLKRLD+D I
Sbjct: 63  NEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKA--KGTPDYVRSCCEASLKRLDVDYI 120
Query: 123 DLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWS 182
           DL+Y HRIDT VPIE+T+GELKKLVEEGKIKY+GLSEAS  TIRRAHAVHP+TA+Q+E+S
Sbjct: 121 DLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEYS 180
Query: 183 LWSRDVEAEIVPTCRELGIGIVAYSPLGRGFF 214
           LW+RD+E EIVP CR+LGIGIV YSP+GRG F
Sbjct: 181 LWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLF 212
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-144
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 1e-143
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-126
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 1e-117
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 1e-106
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 4e-99
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 5e-65
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 1e-62
3erp_A353 Putative oxidoreductase; funded by the national in 8e-57
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 3e-53
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 4e-52
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 4e-51
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 2e-46
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 2e-22
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 4e-22
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 3e-21
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 1e-20
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 2e-19
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-19
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 2e-19
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 5e-19
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 1e-18
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-18
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 9e-18
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 2e-17
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-17
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 3e-17
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-16
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 1e-16
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 2e-16
4gie_A290 Prostaglandin F synthase; structural genomics, nia 4e-16
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 2e-15
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-15
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-15
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 2e-15
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 4e-15
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 4e-15
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 5e-15
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
 Score =  404 bits (1040), Expect = e-144
 Identities = 70/227 (30%), Positives = 111/227 (48%), Gaps = 1/227 (0%)

Query: 6   KRIKLGSQGLEVSAQGLGCMGMS-AFYGPPKPESDMIALIHHAINSGITLLDTSDIYGPH 64
           K+ KLG   L+V   GLG   +      P   E     L+  AI +G+T+LDT+ IYG  
Sbjct: 2   KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIG 61

Query: 65  TNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDL 124
            +E L+G+ L+   RE V +ATK               P +++ + + SLKRL+ D IDL
Sbjct: 62  RSEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDL 121

Query: 125 YYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLW 184
           +Y H  D   P +  +  L ++ + GKI+ IG+S  S   ++ A+    +  +Q E++L 
Sbjct: 122 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 181

Query: 185 SRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQ 231
           +R+ E    P  +E  I  + Y PL  G  +       +F + D R 
Sbjct: 182 NREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGDLRN 228
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.82
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 94.21
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 93.91
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 93.7
2o56_A407 Putative mandelate racemase; dehydratase, structur 93.6
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 92.98
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 92.93
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 92.92
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 92.65
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 92.59
3eez_A378 Putative mandelate racemase/muconate lactonizing e 92.47
2qgy_A391 Enolase from the environmental genome shotgun sequ 92.17
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 91.94
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 91.81
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 91.75
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 91.73
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 91.57
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 91.54
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 91.38
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 91.34
3r0u_A379 Enzyme of enolase superfamily; structural genomics 91.14
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 91.06
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 91.01
2oz8_A389 MLL7089 protein; structural genomics, unknown func 90.99
2gl5_A410 Putative dehydratase protein; structural genomics, 90.8
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 90.65
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 90.64
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 90.36
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 90.15
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 90.14
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 89.86
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 89.8
2poz_A392 Putative dehydratase; octamer, structural genomics 89.74
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 89.71
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 89.51
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 89.47
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 89.44
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 89.31
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 89.26
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 89.19
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 89.09
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 88.44
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 88.13
1tzz_A392 Hypothetical protein L1841; structural genomics, m 87.77
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 87.68
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 87.67
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 87.29
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 86.89
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 86.78
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 86.68
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 86.6
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 86.23
1vpq_A273 Hypothetical protein TM1631; structural genomics, 85.25
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 85.22
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 84.96
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 84.68
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 84.66
3va8_A445 Probable dehydratase; enolase, magnesium binding s 84.34
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 83.29
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 83.14
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 82.98
3otr_A452 Enolase; structural genomics, center for structura 82.93
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 82.27
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 82.25
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 82.15
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 80.67
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 80.49
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 80.01
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
Probab=100.00  E-value=2.3e-56  Score=391.92  Aligned_cols=224  Identities=30%  Similarity=0.509  Sum_probs=202.4

Q ss_pred             CCCcceecCCCCcccCcceecccccCCC-CCCCCCHHHHHHHHHHHHhcCCCEEeCcCCcCCChHHHHHHHHhcCCCCCC
Q 025658            3 GAVKRIKLGSQGLEVSAQGLGCMGMSAF-YGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRER   81 (249)
Q Consensus         3 ~~~~~~~lg~~g~~vs~lglG~~~~g~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~se~~lg~~l~~~~r~~   81 (249)
                      +.|+|++||++|++||+||||||++|+. |+. .+++++.++|++|+++|||+||||+.||+|.||+.+|++|+. +|++
T Consensus        17 m~M~~~~lg~tg~~vs~lglGt~~~g~~~~g~-~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~sE~~lG~al~~-~R~~   94 (348)
T 3n2t_A           17 MASDTIRIPGIDTPLSRVALGTWAIGGWMWGG-PDDDNGVRTIHAALDEGINLIDTAPVYGFGHSEEIVGRALAE-KPNK   94 (348)
T ss_dssp             CTTSEECCTTCSSCEESEEEECTTSSCSSSCS-TTHHHHHHHHHHHHHTTCCEEECCTTGGGGHHHHHHHHHHHH-SCCC
T ss_pred             CCceeeecCCCCCccCCEeEeCccccCCCCCC-CCHHHHHHHHHHHHHcCCCEEEChhhcCCChHHHHHHHHHhh-CCCe
Confidence            3599999999999999999999999864 554 477889999999999999999999999999999999999997 8999


Q ss_pred             eEEEeecCccc--CCC---CCcCCCCHHHHHHHHHHHHHHcCCCccceEEeecCCCCCCHHHHHHHHHHHHHcCcccEEE
Q 025658           82 VELATKFGISF--ADG---KREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIG  156 (249)
Q Consensus        82 ~~i~tK~~~~~--~~~---~~~~~~~~~~i~~~~~~sL~rLg~~~lDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iG  156 (249)
                      ++|+||++..+  .++   ....+.+++.+++++++||+|||+||||+|++|||+...+++++|++|++|+++|+||+||
T Consensus        95 v~I~TK~g~~~~~~~~~~~~~~~~~~~~~i~~~~e~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iG  174 (348)
T 3n2t_A           95 AHVATKLGLHWVGEDEKNMKVFRDSRPARIRKEVEDSLRRLRVETIDLEQIHWPDDKTPIDESARELQKLHQDGKIRALG  174 (348)
T ss_dssp             CEEEEEECEEEESSSTTTCEEEECCCHHHHHHHHHHHHHHHTCSSEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEE
T ss_pred             EEEEEeecCCCcCCCcccccccCCCCHHHHHHHHHHHHHHhCCCcEEEEEecCCCCCCCHHHHHHHHHHHHHhCcceEEe
Confidence            99999997643  111   1223478999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccHHHHHHHhhcCCeeEEeeccCccCcCchhhHHHHHHHcCCeEEEcccCccccCCCCCCCCCCCChhh
Q 025658          157 LSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKED  228 (249)
Q Consensus       157 vs~~~~~~l~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~v~a~spl~~G~l~~~~~~~~~~~~~~  228 (249)
                      ||||++++++++++..+|+++|++||++++..+.+++++|+++||++++|+||++|+|++++.....++..+
T Consensus       175 vSn~~~~~l~~~~~~~~~~~~Q~~~nl~~~~~e~~l~~~~~~~gi~v~a~spL~~G~Ltg~~~~~~~~~~~~  246 (348)
T 3n2t_A          175 VSNFSPEQMDIFREVAPLATIQPPLNLFERTIEKDILPYAEKHNAVVLAYGALCRGLLTGKMNRDTTFPKDD  246 (348)
T ss_dssp             EESCCHHHHHHHHHHSCCCEEECBCBTTBCGGGGTHHHHHHHHTCEEEEBCTTGGGGGGTCCCTTCCCCTTS
T ss_pred             cCCCCHHHHHHHHHhCCccEEEeeecCccCchHHHHHHHHHHcCCeEEEeecccCccccCCccCCCCCCCcc
Confidence            999999999999999999999999999999887899999999999999999999999999987655554433
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1vpq_A Hypothetical protein TM1631; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.1.32.1 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 1e-46
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 8e-44
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 3e-35
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 3e-33
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 2e-32
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 4e-32
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 1e-30
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-30
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-29
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-27
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 1e-27
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 4e-27
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 6e-26
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 1e-25
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 2e-23
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-20
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

 Score =  155 bits (392), Expect = 1e-46
 Identities = 67/215 (31%), Positives = 106/215 (49%), Gaps = 1/215 (0%)

Query: 6   KRIKLGSQGLEVSAQGLGCMGMSAF-YGPPKPESDMIALIHHAINSGITLLDTSDIYGPH 64
           K+ KLG   L+V   GLG   +      P   E     L+  AI +G+T+LDT+ IYG  
Sbjct: 1   KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIG 60

Query: 65  TNEILLGKALKGGMRERVELATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDL 124
            +E L+G+ L+   RE V +ATK               P +++ + + SLKRL+ D IDL
Sbjct: 61  RSEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDL 120

Query: 125 YYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLW 184
           +Y H  D   P +  +  L ++ + GKI+ IG+S  S   ++ A+    +  +Q E++L 
Sbjct: 121 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 180

Query: 185 SRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPK 219
           +R+ E    P  +E  I  + Y PL  G  +    
Sbjct: 181 NREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYT 215
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 92.51
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 92.12
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 92.01
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 91.78
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 91.38
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 89.0
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 88.53
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 88.31
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 88.13
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 87.81
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 87.53
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 83.03
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 82.28
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=2.2e-51  Score=352.98  Aligned_cols=226  Identities=31%  Similarity=0.481  Sum_probs=207.6

Q ss_pred             cceecCCCCcccCcceecccccCCC-CCCCCCHHHHHHHHHHHHhcCCCEEeCcCCcCCChHHHHHHHHhcCCCCCCeEE
Q 025658            6 KRIKLGSQGLEVSAQGLGCMGMSAF-YGPPKPESDMIALIHHAINSGITLLDTSDIYGPHTNEILLGKALKGGMRERVEL   84 (249)
Q Consensus         6 ~~~~lg~~g~~vs~lglG~~~~g~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~se~~lg~~l~~~~r~~~~i   84 (249)
                      ++++||+||++||+||||||++|.. ++...+++++.++|++|+++|||+||||+.||+|.+|+.+|++++..+|++++|
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~sE~~lg~~l~~~~r~~~~i   80 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVI   80 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEE
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCccHHHHhhhhhcccccceec
Confidence            4799999999999999999999864 334567889999999999999999999999999999999999999988999999


Q ss_pred             EeecCcccCCCCCcCCCCHHHHHHHHHHHHHHcCCCccceEEeecCCCCCCHHHHHHHHHHHHHcCcccEEEcCcccHHH
Q 025658           85 ATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEASAST  164 (249)
Q Consensus        85 ~tK~~~~~~~~~~~~~~~~~~i~~~~~~sL~rLg~~~lDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~~~  164 (249)
                      +||++..........+.+++.+++++++||+||+++|+|++++|+|+...+.++++++|++|+++|+|++||+||++++.
T Consensus        81 ~tK~~~~~~~~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~~~  160 (311)
T d1pyfa_          81 ATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQ  160 (311)
T ss_dssp             EEEECEEEETTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHHH
T ss_pred             ceeccCCCCCcccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcHHH
Confidence            99999776544445678999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCCeeEEeeccCccCcCchhhHHHHHHHcCCeEEEcccCccccCCCCCCCCCCCChhhHhh
Q 025658          165 IRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQ  231 (249)
Q Consensus       165 l~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~v~a~spl~~G~l~~~~~~~~~~~~~~~~~  231 (249)
                      +.++.+..+++++|++||++++....+++++|+++||++++|+||++|+|++++.....++..+.+.
T Consensus       161 ~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~~~~~~~~~~~~~~~~~  227 (311)
T d1pyfa_         161 LKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGDLRN  227 (311)
T ss_dssp             HHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTCCCTTCCCCTTCGGG
T ss_pred             HHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCccCCCcCcCCCCccccccc
Confidence            9999999999999999999999888899999999999999999999999999998877776654443
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure