Citrus Sinensis ID: 025661

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25

MAQTMLLMSGVSTSHAGNLKRDSLVTFQTQMLRPKPFSHLMFNPLSNESLTAAAASSSSKAFSTVALFKSKTKAPPKTKKVESKPKVEDGIFGTSGGFGFTKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKGLRSALGLKEGGKGALAQLNIETGIPINEIEPLVLFNVIFFFVAALNPGTGKFVTDEDEE

cccHHHHccccccccccccccccHHHHHHcccccccccccccccccccHHHHccccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccc

*****************************************************************************************GIFGTSGGFGFTKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVD********GGAVIP**KGLRSALGLKEGGKGALAQLNIETGIPINEIEPLVLFNVIFFFVAALNPGT*KF*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Photosystem II 22 kDa protein, chloroplastic	Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.	probable	Q9XF91
Photosystem II 22 kDa protein, chloroplastic	Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.	probable	Q02060
Photosystem II 22 kDa protein, chloroplastic	Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.	probable	P54773

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain 1
Confidence level:probable
Coverage over the Query: 100-143
View the alignment between query and template
View the model in PyMOL