Citrus Sinensis ID: 025663

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MAPATTSSAEARRLIGSRRRTEAPRRMLSPSPPPKKVKSMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVRQMAR
ccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccEEEEccc
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcHHHccccccEEEEEEccccccccEEEEcccccccEEEEcccccccccccccccccccccccccccccEEEEEEEEEEcccccccccccccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHccccEEccHHcHHHHHHHHHHHHccccccEEEEcccc
mapattssAEARRLIGsrrrteaprrmlspspppkkvkSMEEILAKAHYAVvergdygdvgceqcgsgeraEELLLcdkcdkgfhmkclrpivvrvpigtwlcpkcsgqrrvrSFSQRKIIDFfkikkpnlteekcdspqdtrkRRRRSASLVLQKKrrrllpftpsedrsQRLSQMGSLAHALTALQMEfsddltympgmaprsanqaefeeggmqvlskedTETLEQCRAMckrgecpplvVRQMAR
mapattssaearrligsrrrteaprrmlspspppkkvksMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVrvpigtwlcpkcsgqrrvrsfsqrkiidffkikkpnlteekcdspqdtrkrrrrsaslvlqkkrrrllpftpsedrsqRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRamckrgecpplvvrqmar
MAPATTSSAEARRLIGSRRRTEAPRRMLspspppkkvksMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVRQMAR
******************************************ILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIK**************************************************************************************************************************
*******************************************************DYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCS***********************************************************************************************************************LEQCRAMCKRGECPPLVVRQM**
***********RRLIGSR********************SMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNLTE*****************SLVLQKKRRRLLPFTP*********QMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVRQMAR
************************************VKSMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKP**************************KKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVRQ***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPATTSSAEARRLIGSRRRTEAPRRMLSPSPPPKKVKSMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVRQMAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q8VZJ1 352 Histone-lysine N-methyltr no no 0.803 0.568 0.596 5e-68
Q9FNE9 349 Histone-lysine N-methyltr no no 0.730 0.521 0.567 5e-53
A6H619 1682 PHD and RING finger domai yes no 0.184 0.027 0.521 7e-11
Q9P1Y6 1649 PHD and RING finger domai yes no 0.184 0.027 0.521 9e-11
Q63625 1685 PHD and RING finger domai yes no 0.184 0.027 0.521 9e-11
Q9UIF82168 Bromodomain adjacent to z no no 0.481 0.055 0.330 1e-09
Q9DE132130 Bromodomain adjacent to z yes no 0.453 0.053 0.350 2e-09
Q96T23 1441 Remodeling and spacing fa no no 0.192 0.033 0.479 3e-09
Q8BZ21 2003 Histone acetyltransferase no no 0.240 0.029 0.390 4e-09
Q5TKR9 1998 Histone acetyltransferase yes no 0.240 0.030 0.390 4e-09
>sp|Q8VZJ1|ATXR5_ARATH Histone-lysine N-methyltransferase ATXR5 OS=Arabidopsis thaliana GN=ATXR5 PE=2 SV=1 Back     alignment and function desciption
 Score =  257 bits (657), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 139/233 (59%), Positives = 167/233 (71%), Gaps = 33/233 (14%)

Query: 18  RRRTEAP-RRMLSPSPPPKKVKSMEEILAKAHYAVVERG-----DYGDVGCEQCGSGERA 71
           RRRT+AP RR  S SPPP+K+KSM EI+AK+   V +        Y +V CE+CGSGE  
Sbjct: 17  RRRTKAPARRPSSESPPPRKMKSMAEIMAKSVPVVEQEEEEDEDSYSNVTCEKCGSGEGD 76

Query: 72  EELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNL 131
           +ELLLCDKCD+GFHMKCLRPIVVRVPIGTWLC  CS QR VR                  
Sbjct: 77  DELLLCDKCDRGFHMKCLRPIVVRVPIGTWLCVDCSDQRPVR------------------ 118

Query: 132 TEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEF 191
                   ++TRKRRR S SL ++K+RR+LLP  PSED  QRL+QMG+LA ALTAL +++
Sbjct: 119 --------KETRKRRR-SCSLTVKKRRRKLLPLVPSEDPDQRLAQMGTLASALTALGIKY 169

Query: 192 SDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVV 244
           SD L Y+PGMAPRSANQ++ E+GGMQVL KED ETLEQC++M +RGECPPLVV
Sbjct: 170 SDGLNYVPGMAPRSANQSKLEKGGMQVLCKEDLETLEQCQSMYRRGECPPLVV 222
Histone methyltransferase.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|Q9FNE9|ATXR6_ARATH Histone-lysine N-methyltransferase ATXR6 OS=Arabidopsis thaliana GN=ATXR6 PE=2 SV=1 Back     alignment and function description
>sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 Back     alignment and function description
>sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 Back     alignment and function description
>sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 Back     alignment and function description
>sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens GN=RSF1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BZ21|KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus GN=Kat6a PE=1 SV=2 Back     alignment and function description
>sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
255552380 374 Histone-lysine N-methyltransferase ATXR6 0.971 0.647 0.772 1e-100
225431531 374 PREDICTED: histone-lysine N-methyltransf 0.907 0.604 0.729 2e-91
449511173 378 PREDICTED: histone-lysine N-methyltransf 0.979 0.645 0.709 6e-89
449459284 385 PREDICTED: histone-lysine N-methyltransf 0.919 0.594 0.729 9e-89
356508991 375 PREDICTED: histone-lysine N-methyltransf 0.979 0.650 0.653 1e-87
356516345 375 PREDICTED: histone-lysine N-methyltransf 0.979 0.650 0.644 7e-86
9759010 378 unnamed protein product [Arabidopsis tha 0.907 0.597 0.639 6e-76
71388893 379 ATXR5 [Arabidopsis thaliana] 0.911 0.598 0.626 9e-76
145334355 379 histone-lysine N-methyltransferase ATXR5 0.911 0.598 0.626 9e-76
297811079 379 hypothetical protein ARALYDRAFT_487800 [ 0.975 0.641 0.608 1e-73
>gi|255552380|ref|XP_002517234.1| Histone-lysine N-methyltransferase ATXR6, putative [Ricinus communis] gi|223543605|gb|EEF45134.1| Histone-lysine N-methyltransferase ATXR6, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 208/246 (84%), Gaps = 4/246 (1%)

Query: 1   MAPA--TTSSAEARRLIGSRRRTEAPRRMLSPSPPPKKVKSMEEILAKAHYAVVERGDYG 58
           MAPA  TT++  ARR++GSRRRT+A       SPPPKK+K + EILAKA YAVVER DYG
Sbjct: 1   MAPASITTTTTVARRIVGSRRRTKAT--SPPDSPPPKKLKPISEILAKAQYAVVERADYG 58

Query: 59  DVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQR 118
           DV C QCGSGERAEELLLCDKCDKGFHMKC+RPIVVRVPIG+WLCPKCSGQRRVR  SQR
Sbjct: 59  DVSCMQCGSGERAEELLLCDKCDKGFHMKCVRPIVVRVPIGSWLCPKCSGQRRVRRLSQR 118

Query: 119 KIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMG 178
           KIIDFF+I+K N   +KC SPQD RK RRRS SLV QK+RRRLLPF  SED +QRL QMG
Sbjct: 119 KIIDFFRIQKCNHKTDKCSSPQDIRKHRRRSGSLVYQKRRRRLLPFVSSEDPAQRLKQMG 178

Query: 179 SLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGE 238
           +LA ALT LQMEFSDDLTY  GMAPRSANQA FEEGGMQVL+KED ETLEQCRAMCKRG+
Sbjct: 179 TLASALTELQMEFSDDLTYSSGMAPRSANQARFEEGGMQVLTKEDIETLEQCRAMCKRGD 238

Query: 239 CPPLVV 244
           CPPL+V
Sbjct: 239 CPPLLV 244

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431531|ref|XP_002281774.1| PREDICTED: histone-lysine N-methyltransferase ATXR5 [Vitis vinifera] gi|296088576|emb|CBI37567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449511173|ref|XP_004163884.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459284|ref|XP_004147376.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356508991|ref|XP_003523236.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Glycine max] Back     alignment and taxonomy information
>gi|356516345|ref|XP_003526856.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Glycine max] Back     alignment and taxonomy information
>gi|9759010|dbj|BAB09537.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|71388893|gb|AAZ31374.1| ATXR5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145334355|ref|NP_001078559.1| histone-lysine N-methyltransferase ATXR5 [Arabidopsis thaliana] gi|7671410|emb|CAB89351.1| putative protein [Arabidopsis thaliana] gi|332004064|gb|AED91447.1| histone-lysine N-methyltransferase ATXR5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297811079|ref|XP_002873423.1| hypothetical protein ARALYDRAFT_487800 [Arabidopsis lyrata subsp. lyrata] gi|297319260|gb|EFH49682.1| hypothetical protein ARALYDRAFT_487800 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2144841 379 ATXR5 "AT5G09790" [Arabidopsis 0.951 0.625 0.583 2.4e-69
TAIR|locus:2169779 349 ATXR6 "AT5G24330" [Arabidopsis 0.742 0.530 0.563 1.7e-52
ZFIN|ZDB-GENE-041010-2021305 baz2a "bromodomain adjacent to 0.582 0.111 0.322 1e-13
ZFIN|ZDB-GENE-030131-624 1670 phrf1 "PHD and ring finger dom 0.586 0.087 0.284 7.5e-11
UNIPROTKB|F1NRS91981 BAZ2B "Bromodomain adjacent to 0.518 0.065 0.340 3.8e-10
UNIPROTKB|F1P2F72125 BAZ2B "Bromodomain adjacent to 0.518 0.060 0.340 4.1e-10
UNIPROTKB|E1C3I82126 BAZ2B "Bromodomain adjacent to 0.518 0.060 0.340 4.1e-10
UNIPROTKB|Q9DE132130 BAZ2B "Bromodomain adjacent to 0.518 0.060 0.340 4.2e-10
UNIPROTKB|I3LU11 1643 PHRF1 "Uncharacterized protein 0.184 0.027 0.521 4.7e-10
UNIPROTKB|H0YDG9276 RSF1 "Remodeling and spacing f 0.180 0.163 0.488 1.1e-09
TAIR|locus:2144841 ATXR5 "AT5G09790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 703 (252.5 bits), Expect = 2.4e-69, P = 2.4e-69
 Identities = 143/245 (58%), Positives = 179/245 (73%)

Query:     7 SSAEARRLIGSRRRTEAP-RRMLXXXXXXXXXXXMEEILAKAHYAVVERGD------YGD 59
             +S+ A     SRRRT+AP RR             M EI+AK+   VVE+ +      Y +
Sbjct:     6 ASSPAASPCSSRRRTKAPARRPSSESPPPRKMKSMAEIMAKS-VPVVEQEEEEDEDSYSN 64

Query:    60 VGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRK 119
             V CE+CGSGE  +ELLLCDKCD+GFHMKCLRPIVVRVPIGTWLC  CS QR VR  SQ+K
Sbjct:    65 VTCEKCGSGEGDDELLLCDKCDRGFHMKCLRPIVVRVPIGTWLCVDCSDQRPVRRLSQKK 124

Query:   120 IIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGS 179
             I+ FF+I+K     +K +  Q+  ++RRRS SL ++K+RR+LLP  PSED  QRL+QMG+
Sbjct:   125 ILHFFRIEKHTHQTDKLELSQEETRKRRRSCSLTVKKRRRKLLPLVPSEDPDQRLAQMGT 184

Query:   180 LAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGEC 239
             LA ALTAL +++SD L Y+PGMAPRSANQ++ E+GGMQVL KED ETLEQC++M +RGEC
Sbjct:   185 LASALTALGIKYSDGLNYVPGMAPRSANQSKLEKGGMQVLCKEDLETLEQCQSMYRRGEC 244

Query:   240 PPLVV 244
             PPLVV
Sbjct:   245 PPLVV 249
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009507 "chloroplast" evidence=IDA
GO:0009555 "pollen development" evidence=IMP
GO:0051726 "regulation of cell cycle" evidence=IEP
GO:0009294 "DNA mediated transformation" evidence=IMP
GO:0046976 "histone methyltransferase activity (H3-K27 specific)" evidence=IDA
GO:0070734 "histone H3-K27 methylation" evidence=IDA
GO:0006275 "regulation of DNA replication" evidence=IGI
TAIR|locus:2169779 ATXR6 "AT5G24330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-202 baz2a "bromodomain adjacent to zinc finger domain, 2A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-624 phrf1 "PHD and ring finger domains 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRS9 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2F7 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3I8 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DE13 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LU11 PHRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDG9 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
pfam0062851 pfam00628, PHD, PHD-finger 4e-10
smart0024947 smart00249, PHD, PHD zinc finger 3e-09
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 6e-05
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 53.6 bits (129), Expect = 4e-10
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 62  CEQCGSGERAEELLLCDKCDKGFHMKCLRP--IVVRVPIGTWLCPKCS 107
           C  CG  +   ELLLCD CD+ FH+ CL P      +P G W CP+C 
Sbjct: 2   CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECK 49

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
KOG1244336 consensus Predicted transcription factor Requiem/N 99.14
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 99.13
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 99.11
KOG1973274 consensus Chromatin remodeling protein, contains P 98.95
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.9
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.89
KOG4299 613 consensus PHD Zn-finger protein [General function 98.87
KOG1512381 consensus PHD Zn-finger protein [General function 98.7
KOG1083 1306 consensus Putative transcription factor ASH1/LIN-5 98.48
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.4
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.29
KOG0954 893 consensus PHD finger protein [General function pre 98.26
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 98.16
COG5141 669 PHD zinc finger-containing protein [General functi 98.09
KOG0383 696 consensus Predicted helicase [General function pre 98.04
KOG0957707 consensus PHD finger protein [General function pre 98.03
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.96
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.89
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.81
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.75
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 97.73
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 96.12
KOG0957 707 consensus PHD finger protein [General function pre 95.17
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 94.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.51
KOG1512381 consensus PHD Zn-finger protein [General function 92.28
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 91.67
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 91.36
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 90.96
KOG0383 696 consensus Predicted helicase [General function pre 89.78
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 89.34
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 88.7
KOG4299 613 consensus PHD Zn-finger protein [General function 88.1
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 86.55
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 84.46
PF13901202 DUF4206: Domain of unknown function (DUF4206) 83.76
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 80.5
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information 
Probab=99.14  E-value=1.3e-11  Score=109.28  Aligned_cols=51  Identities=43%  Similarity=1.058  Sum_probs=48.1

Q ss_pred             cccccccccccCCCCceeecccCCcccccccCCcCCCCCCCCccCcccccC
Q 025663           59 DVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQ  109 (249)
Q Consensus        59 ~~~C~vC~~~~~~~~~l~CD~C~~~fH~~Cl~P~l~~~p~g~W~Cp~C~~~  109 (249)
                      ..+|.+|+..++.+++|+||.|+++||++||.||+.+.|+|.|.|-.|...
T Consensus       281 ck~csicgtsenddqllfcddcdrgyhmyclsppm~eppegswsc~KOG~~  331 (336)
T KOG1244|consen  281 CKYCSICGTSENDDQLLFCDDCDRGYHMYCLSPPMVEPPEGSWSCHLCLEE  331 (336)
T ss_pred             cceeccccCcCCCceeEeecccCCceeeEecCCCcCCCCCCchhHHHHHHH
Confidence            578999999999999999999999999999999999999999999999853

>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1083 consensus Putative transcription factor ASH1/LIN-59 [Transcription] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 8e-08
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 2e-07
3v43_A112 Crystal Structure Of Moz Length = 112 2e-07
2ln0_A110 Structure Of Moz Length = 110 2e-07
1f62_A51 Wstf-Phd Length = 51 6e-07
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 5e-06
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 8e-06
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 8e-06
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 9e-06
2ysm_A111 Solution Structure Of The First And Second Phd Doma 1e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 1e-05
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 1e-05
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 1e-05
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 1e-05
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 4e-05
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 1e-04
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 1e-04
3zvy_A72 Phd Finger Of Human Uhrf1 In Complex With Unmodifie 1e-04
3sou_A70 Structure Of Uhrf1 Phd Finger In Complex With Histo 1e-04
3shb_A77 Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 1e-04
2lgg_A69 Structure Of Phd Domain Of Uhrf1 In Complex With H3 1e-04
3t6r_A72 Structure Of Uhrf1 In Complex With Unmodified H3 N- 1e-04
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 2e-04
2e6s_A77 Solution Structure Of The Phd Domain In Ring Finger 6e-04
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 28/45 (62%)
Query: 62  CEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKC 106
           C  CG+ E  ++LL CD CD+G+HM CL P V   P G+W C  C
Sbjct: 61  CILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLC 105
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 Back     alignment and structure
>pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 Back     alignment and structure
>pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 Back     alignment and structure
>pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 2e-19
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 1e-18
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 2e-17
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-17
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 3e-17
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 8e-17
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-16
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 3e-15
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 5e-15
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 5e-15
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 9e-15
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 5e-12
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-14
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-14
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-13
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-06
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 2e-13
2k16_A75 Transcription initiation factor TFIID subunit 3; p 7e-13
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 1e-12
2yt5_A66 Metal-response element-binding transcription facto 7e-12
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 2e-11
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-10
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-08
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 8e-08
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 2e-07
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 6e-07
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 2e-06
1x4i_A70 Inhibitor of growth protein 3; structural genomics 3e-05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 9e-05
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 1e-04
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 3e-04
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 4e-04
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 5e-04
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 5e-04
1weu_A91 Inhibitor of growth family, member 4; structural g 7e-04
1wem_A76 Death associated transcription factor 1; structura 7e-04
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
 Score = 77.8 bits (192), Expect = 2e-19
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 62  CEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCS 107
           C+ C      ++L+LCD+C+K FH+ CLRP +  VP G W CP C 
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQ 48
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.58
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.57
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.57
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.56
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.55
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.54
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.53
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.52
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.52
2yt5_A66 Metal-response element-binding transcription facto 99.48
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.47
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.46
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.44
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.44
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.43
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.43
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.42
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.4
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.39
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.32
1weu_A91 Inhibitor of growth family, member 4; structural g 99.31
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.3
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.3
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.29
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.26
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.26
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.26
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.25
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.24
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.21
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.2
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.18
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.05
1we9_A64 PHD finger family protein; structural genomics, PH 99.0
1wee_A72 PHD finger family protein; structural genomics, PH 99.0
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.98
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.97
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.96
1wem_A76 Death associated transcription factor 1; structura 98.96
1wew_A78 DNA-binding family protein; structural genomics, P 98.9
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.89
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 98.85
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.82
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.81
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 98.77
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.75
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.74
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.69
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.65
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.41
3kv5_D 488 JMJC domain-containing histone demethylation prote 98.32
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.31
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.26
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 98.08
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 97.96
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.9
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.24
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.05
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 95.36
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 94.86
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 94.42
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 94.04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 93.33
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 93.16
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 92.73
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 92.37
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 92.08
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 91.66
2ect_A78 Ring finger protein 126; metal binding protein, st 90.58
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 89.49
2ecm_A55 Ring finger and CHY zinc finger domain- containing 89.33
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 88.9
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 88.2
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 87.96
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 87.02
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 86.83
1weq_A85 PHD finger protein 7; structural genomics, PHD dom 82.58
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 80.65
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
Probab=99.58  E-value=9.1e-16  Score=107.35  Aligned_cols=53  Identities=40%  Similarity=0.979  Sum_probs=48.3

Q ss_pred             ccccccccccccccccCCCCceeecccCCcccccccCCcCCCCCCCCccCcccccC
Q 025663           54 RGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQ  109 (249)
Q Consensus        54 ~~~~~~~~C~vC~~~~~~~~~l~CD~C~~~fH~~Cl~P~l~~~p~g~W~Cp~C~~~  109 (249)
                      +++.++.+|.+|+.+   ++||+||.|+++||++|++|++..+|.|+|+|+.|...
T Consensus         4 ~~d~~~~~C~vC~~~---g~ll~Cd~C~~~fH~~Cl~ppl~~~p~g~W~C~~C~~~   56 (61)
T 1mm2_A            4 GSDHHMEFCRVCKDG---GELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCP   56 (61)
T ss_dssp             CSCSSCSSCTTTCCC---SSCBCCSSSCCCBCSSSSSSCCSSCCSSCCCCTTTTTT
T ss_pred             cccCCCCcCCCCCCC---CCEEEcCCCCHHHcccccCCCcCcCCCCccCChhhcCc
Confidence            445668899999986   89999999999999999999999999999999999865
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-13
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-12
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 4e-12
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 5e-11
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-09
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 6e-09
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-08
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 2e-04
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 3e-04
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 0.002
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 61.5 bits (149), Expect = 1e-13
 Identities = 21/45 (46%), Positives = 29/45 (64%)

Query: 62  CEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKC 106
           C+ C      ++L+LCD+C+K FH+ CLRP +  VP G W CP C
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.45
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.45
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.45
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 99.18
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.11
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.08
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.06
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.99
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.87
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.84
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 98.79
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 95.9
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 94.55
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 93.51
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 88.44
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 88.19
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 87.65
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 81.31
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.45  E-value=1.1e-14  Score=96.40  Aligned_cols=48  Identities=44%  Similarity=1.139  Sum_probs=45.2

Q ss_pred             cccccccccCCCCceeecccCCcccccccCCcCCCCCCCCccCccccc
Q 025663           61 GCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSG  108 (249)
Q Consensus        61 ~C~vC~~~~~~~~~l~CD~C~~~fH~~Cl~P~l~~~p~g~W~Cp~C~~  108 (249)
                      .|.+|+..++.+.||+||.|+.+||+.|++|++..+|.++|+|+.|..
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~   49 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP   49 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcC
Confidence            588999988889999999999999999999999999999999999975
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure