Citrus Sinensis ID: 025676

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALEEMDAD
cccccccccccccccccccccHHHHHHHHHHHccccEEEEEcccEEEEEEEcccccccccccccccCEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEEccccccccccEEEEcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEECccccEEEEccHHHHHHHHHHHHHHHHHHccc
*****TGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKA************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALEEMDAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit alpha type-3 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentO23715
Proteasome subunit alpha type-3 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentO24362
Proteasome subunit alpha type-3 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentQ9LSU0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.25.-Threonine endopeptidases.probable
3.4.25.1Transferred entry: 3.4.25.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain G
Confidence level:very confident
Coverage over the Query: 2-244
View the alignment between query and template
View the model in PyMOL