Citrus Sinensis ID: 025758


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MLWVDKYRPKTLDQVIVHQDIAQNLKKLVTEQDCPHLLFYGPPGSGKKTLIMALLRQVFGPGAEKVKVENKTWKIDAGSRNIDLELTTLSSANHVELSPSDAGFQDRYVVQEVIKEMAKNRPIDTKGKRGFKVLVLNEVDKLSREAQHSLRRTMEKYSASCRLILCCNSSSKVTEAIRSRCLNIRINSPTEEQIVKVLEFIAKKEGLQLPSGFATRLAEKSNRSLRRAILSFETCRVQQLRFTMPSVD
ccccccccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHccccccccCECccccccccccccccccEEECccccEEEEcccccccccHHHHHHHHHHHHHcccccccccccEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHccccEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccc
MLWVDKYRPKTLDQVIVHQDIAQNLKKLVTEQDCPHLLFYGPPGSGKKTLIMALLRQVFGPGAEKVKVENKTWKIDAGSRNIDLELTTLSSANHVELSPSDAGFQDRYVVQEVIKEMAKNRPIDTKGKRGFKVLVLNEVDKLSREAQHSLRRTMEKYSASCRLILCCNSSSKVTEAIRSRCLNIRINSPTEEQIVKVLEFIAKKEGLQLPSGFATRLAEKSNRSLRRAILSFETCRVQQLRF******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLWVDKYRPKTLDQVIVHQDIAQNLKKLVTEQDCPHLLFYGPPGSGKKTLIMALLRQVFGPGAEKVKVENKTWKIDAGSRNIDLELTTLSSANHVELSPSDAGFQDRYVVQEVIKEMAKNRPIDTKGKRGFKVLVLNEVDKLSREAQHSLRRTMEKYSASCRLILCCNSSSKVTEAIRSRCLNIRINSPTEEQIVKVLEFIAKKEGLQLPSGFATRLAEKSNRSLRRAILSFETCRVQQLRFTMPSVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Replication factor C subunit 3 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.probableQ8R323
Replication factor C subunit 3 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.probableQ2TBV1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IQP, chain A
Confidence level:very confident
Coverage over the Query: 1-65,93-240
View the alignment between query and template
View the model in PyMOL
Template: 1SXJ, chain E
Confidence level:very confident
Coverage over the Query: 3-65,87-244
View the alignment between query and template
View the model in PyMOL