Citrus Sinensis ID: 025765

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRRERDSVATTASPAPSLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR
cHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccccEEECcccccccccEEECccccccccccccccccccHHHHHcccc
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQ****C**EIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELR****************************************************************LDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLxxxxxxxxxxxxxxxxxxxxxIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHxxxxxxxxxxxxxxxxxxxxxVATTASPAPSLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PHD finger protein ING1 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.probableQ9LIQ6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WEU, chain A
Confidence level:very confident
Coverage over the Query: 180-246
View the alignment between query and template
View the model in PyMOL
Template: 4AFL, chain A
Confidence level:confident
Coverage over the Query: 8-110
View the alignment between query and template
View the model in PyMOL