Citrus Sinensis ID: 025765

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRRERDSVATTASPAPSLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR
cHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccccEEEEcccccccccEEEEcccccccccccccccccHHHHHHHccc
ccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEcccEEEcccccccEEEEEEccccccccccccEccccccHHHHHcccc
MFKRFQVFLLTFmdiffpplvrdaQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIragnitpntslirfsddaldeqkhsIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRRERdsvattaspapsldgstksgrsseggrggrkkTRLATAAAAAAAAVTEaaatpvanptgmeldlpvdpneptycvcnqvsygemvacdnpnckiewfhfgcvglkeqpkgkwycpdcaalknrrkgr
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIragnitpntslirFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRRERdsvattaspapsldgstksgrsseggrggrKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLkeqpkgkwycpdcaalknrrkgr
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRRERDSVATTASPAPSLDgstksgrsseggrggrkktrLataaaaaaaavteaaatpvaNPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR
***RFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQ****C**EIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNF***********************************************************************LPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAAL*******
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEI*************************************************EKVALAVQAYDLVDTHIQQLDQYLKNFDEELRRERDSVATT*******************************************************LDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCA**K******
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELR*****************************************************ATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELR***************************************************************ELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAAL*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKRFQVFLLTFMDIFFPPLVRDAQMQCFFVHTLxxxxxxxxxxxxxxxxxxxxxIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHxxxxxxxxxxxxxxxxxxxxxVATTASPAPSLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
Q9LIQ6234 PHD finger protein ING1 O yes no 0.822 0.871 0.680 2e-72
Q9D8Y8240 Inhibitor of growth prote yes no 0.596 0.616 0.420 1e-33
Q8C0D7249 Inhibitor of growth prote no no 0.830 0.827 0.350 7e-33
Q9UNL4249 Inhibitor of growth prote yes no 0.633 0.630 0.378 2e-32
Q5ZKY4249 Inhibitor of growth prote yes no 0.649 0.646 0.375 3e-32
Q8WYH8240 Inhibitor of growth prote no no 0.653 0.675 0.413 6e-32
Q3T095248 Inhibitor of growth prote no no 0.633 0.633 0.380 6e-31
B3H615262 PHD finger protein ING2 O no no 0.661 0.625 0.402 5e-29
Q66KD5417 Inhibitor of growth prote no no 0.318 0.189 0.625 1e-27
Q7ZX31416 Inhibitor of growth prote N/A no 0.318 0.189 0.625 1e-27
>sp|Q9LIQ6|ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana GN=ING1 PE=1 SV=1 Back     alignment and function desciption
 Score =  271 bits (694), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 175/216 (81%), Gaps = 12/216 (5%)

Query: 33  TLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALA 92
           +L E QRQNEQRCE+EIED+ R  RAGNITPNTSL +FS++ALDEQKHS+RIADEKV LA
Sbjct: 31  SLQENQRQNEQRCEKEIEDI-RRGRAGNITPNTSLTKFSEEALDEQKHSVRIADEKVTLA 89

Query: 93  VQAYDLVDTHIQQLDQYLKNFDEELRRERDSVATTASPAPSLDGSTKSGRSSEGGRGGRK 152
           +QAYDLVD H+QQLDQY+K  DE +R+E+++ A T      L+ + K+G + EGGRGGRK
Sbjct: 90  MQAYDLVDMHVQQLDQYMKKSDEVIRKEKEAAAATLE----LENNGKAGNAGEGGRGGRK 145

Query: 153 KTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPN 212
           KTRLATAA+ AAA+    +       + M+LDLPVDPNEPTYC+CNQVS+GEMVACDN  
Sbjct: 146 KTRLATAASTAAASTGMTS-------SNMDLDLPVDPNEPTYCICNQVSFGEMVACDNNA 198

Query: 213 CKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR 248
           CKIEWFHFGCVGLKEQPKGKWYCP+CA +K  RKGR
Sbjct: 199 CKIEWFHFGCVGLKEQPKGKWYCPECATVKKSRKGR 234
Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9D8Y8|ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus GN=Ing5 PE=1 SV=1 Back     alignment and function description
>sp|Q8C0D7|ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus GN=Ing4 PE=1 SV=2 Back     alignment and function description
>sp|Q9UNL4|ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens GN=ING4 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZKY4|ING4_CHICK Inhibitor of growth protein 4 OS=Gallus gallus GN=ING4 PE=2 SV=1 Back     alignment and function description
>sp|Q8WYH8|ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens GN=ING5 PE=1 SV=1 Back     alignment and function description
>sp|Q3T095|ING4_BOVIN Inhibitor of growth protein 4 OS=Bos taurus GN=ING4 PE=2 SV=1 Back     alignment and function description
>sp|B3H615|ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana GN=ING2 PE=1 SV=1 Back     alignment and function description
>sp|Q66KD5|ING3_XENTR Inhibitor of growth protein 3 OS=Xenopus tropicalis GN=ing3 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZX31|ING3_XENLA Inhibitor of growth protein 3 OS=Xenopus laevis GN=ing3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
356534854242 PREDICTED: inhibitor of growth protein 4 0.846 0.867 0.752 1e-91
255637739239 unknown [Glycine max] 0.834 0.866 0.747 8e-91
356575180239 PREDICTED: inhibitor of growth protein 5 0.834 0.866 0.743 2e-90
255554260242 Inhibitor of growth protein, putative [R 0.854 0.876 0.814 4e-88
225433377235 PREDICTED: PHD finger protein ING1 [Viti 0.842 0.889 0.740 4e-88
449432470239 PREDICTED: PHD finger protein ING1-like 0.846 0.878 0.751 2e-82
224075575246 predicted protein [Populus trichocarpa] 0.862 0.869 0.755 5e-82
388490518245 unknown [Lotus japonicus] 0.866 0.877 0.736 1e-81
388512117247 unknown [Medicago truncatula] 0.967 0.971 0.671 2e-81
217072216247 unknown [Medicago truncatula] 0.967 0.971 0.671 2e-81
>gi|356534854|ref|XP_003535966.1| PREDICTED: inhibitor of growth protein 4-like [Glycine max] Back     alignment and taxonomy information
 Score =  342 bits (876), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 184/218 (84%), Gaps = 8/218 (3%)

Query: 33  TLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVALA 92
           +L +IQRQNEQRCEQEIED+ R +R+GNITP+TS+IRFSD+ALDEQ HSIR+ADEKVALA
Sbjct: 31  SLHDIQRQNEQRCEQEIEDIRRGVRSGNITPDTSVIRFSDEALDEQNHSIRVADEKVALA 90

Query: 93  VQAYDLVDTHIQQLDQYLKNFDEELRRERDSVATTASPAPSLDGSTKSGRSSEG--GRGG 150
           VQAYDLVDTHIQ LDQYLK F EE+RRER++ A T  PA   +G+TKSGR +E   GRGG
Sbjct: 91  VQAYDLVDTHIQHLDQYLKRFGEEIRRERENAAITGVPASGSEGNTKSGRGNESGTGRGG 150

Query: 151 RKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDN 210
           RKKTR  T   AA    TEA AT  ANPTGM+L+LPVDPNEPTYC CNQVSYG MVACDN
Sbjct: 151 RKKTRQTTVTPAA----TEAQAT--ANPTGMDLELPVDPNEPTYCFCNQVSYGAMVACDN 204

Query: 211 PNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKGR 248
           PNCKIEWFHFGCVGLKEQPKGKWYC +CAA KNRR+G+
Sbjct: 205 PNCKIEWFHFGCVGLKEQPKGKWYCSNCAATKNRRRGK 242

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255637739|gb|ACU19192.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356575180|ref|XP_003555720.1| PREDICTED: inhibitor of growth protein 5-like [Glycine max] Back     alignment and taxonomy information
>gi|255554260|ref|XP_002518170.1| Inhibitor of growth protein, putative [Ricinus communis] gi|223542766|gb|EEF44303.1| Inhibitor of growth protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225433377|ref|XP_002285610.1| PREDICTED: PHD finger protein ING1 [Vitis vinifera] gi|297741895|emb|CBI33330.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432470|ref|XP_004134022.1| PREDICTED: PHD finger protein ING1-like [Cucumis sativus] gi|449487502|ref|XP_004157658.1| PREDICTED: PHD finger protein ING1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224075575|ref|XP_002304691.1| predicted protein [Populus trichocarpa] gi|222842123|gb|EEE79670.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388490518|gb|AFK33325.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388512117|gb|AFK44120.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217072216|gb|ACJ84468.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2076141234 ING1 "AT3G24010" [Arabidopsis 0.282 0.299 0.828 1.2e-67
DICTYBASE|DDB_G0284411324 dng1 "inhibitor of growth (ING 0.270 0.206 0.681 3.1e-35
UNIPROTKB|Q66KD5417 ing3 "Inhibitor of growth prot 0.282 0.167 0.671 5e-35
UNIPROTKB|Q7ZX31416 ing3 "Inhibitor of growth prot 0.282 0.168 0.671 5e-35
ZFIN|ZDB-GENE-040109-3416 ing3 "inhibitor of growth fami 0.282 0.168 0.671 6.3e-35
UNIPROTKB|Q5ZK36417 ING3 "Inhibitor of growth prot 0.270 0.160 0.686 8.1e-35
UNIPROTKB|E1BQ25418 ING3 "Uncharacterized protein" 0.270 0.160 0.686 8.1e-35
UNIPROTKB|E2R0U9418 ING3 "Uncharacterized protein" 0.270 0.160 0.686 8.1e-35
UNIPROTKB|E7ET07403 ING3 "Inhibitor of growth prot 0.270 0.166 0.686 8.1e-35
UNIPROTKB|Q9NXR8418 ING3 "Inhibitor of growth prot 0.270 0.160 0.686 8.1e-35
TAIR|locus:2076141 ING1 "AT3G24010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 356 (130.4 bits), Expect = 1.2e-67, Sum P(2) = 1.2e-67
 Identities = 58/70 (82%), Positives = 64/70 (91%)

Query:   179 TGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDC 238
             + M+LDLPVDPNEPTYC+CNQVS+GEMVACDN  CKIEWFHFGCVGLKEQPKGKWYCP+C
Sbjct:   165 SNMDLDLPVDPNEPTYCICNQVSFGEMVACDNNACKIEWFHFGCVGLKEQPKGKWYCPEC 224

Query:   239 AALKNRRKGR 248
             A +K  RKGR
Sbjct:   225 ATVKKSRKGR 234
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0035064 "methylated histone residue binding" evidence=IDA
DICTYBASE|DDB_G0284411 dng1 "inhibitor of growth (ING) family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q66KD5 ing3 "Inhibitor of growth protein 3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZX31 ing3 "Inhibitor of growth protein 3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040109-3 ing3 "inhibitor of growth family, member 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZK36 ING3 "Inhibitor of growth protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQ25 ING3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0U9 ING3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7ET07 ING3 "Inhibitor of growth protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXR8 ING3 "Inhibitor of growth protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LIQ6ING1_ARATHNo assigned EC number0.68050.82250.8717yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_III1972
hypothetical protein (246 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 8e-33
pfam12998104 pfam12998, ING, Inhibitor of growth proteins N-ter 2e-16
pfam0062851 pfam00628, PHD, PHD-finger 3e-09
smart0024947 smart00249, PHD, PHD zinc finger 6e-07
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information 
 Score =  120 bits (301), Expect = 8e-33
 Identities = 69/243 (28%), Positives = 90/243 (37%), Gaps = 36/243 (14%)

Query: 30  FVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKV 89
            +  +        +   Q I  L + I   + T          +  +    +I I  EK 
Sbjct: 27  ELSEIDAKVCDIIKNLRQMISILKKIIDLDSQTYEEVEDGLLKEIRELLLKAIYIQKEKS 86

Query: 90  ALAVQAYDLVDTHIQQLDQ-----YLKNFDEELRRERDSVATTA-----SPAPSLDGSTK 139
            LA +A  L+  H + LD        +     +    D+V+        S A    G  +
Sbjct: 87  DLADRAEKLLRRHRKLLDDRIAKRPHEKVAARIENCHDAVSRLERNSYSSAARRSSGEHR 146

Query: 140 SGRSSEGGRGGRKKTRLATAAA-----------------------AAAAAVTEAAATP-V 175
           S  SS+G R  + K R                               A  V E       
Sbjct: 147 SAASSQGSRHTKLKKRKNIHNLKRRSPELSSKREVSFTLESPSVPDTATRVKEGNNGGST 206

Query: 176 ANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYC 235
            +      D      E  YC C QVSYG+MVACDN NCK EWFH  CVGLKE PKGKWYC
Sbjct: 207 KSRGVSSEDNSEG--EELYCFCQQVSYGQMVACDNANCKREWFHLECVGLKEPPKGKWYC 264

Query: 236 PDC 238
           P+C
Sbjct: 265 PEC 267

Length = 271
>gnl|CDD|221887 pfam12998, ING, Inhibitor of growth proteins N-terminal histone-binding Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 100.0
KOG1973274 consensus Chromatin remodeling protein, contains P 100.0
PF12998105 ING: Inhibitor of growth proteins N-terminal histo 99.89
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.86
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.72
KOG1512381 consensus PHD Zn-finger protein [General function 97.98
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.51
KOG4299 613 consensus PHD Zn-finger protein [General function 97.5
KOG0954 893 consensus PHD finger protein [General function pre 97.48
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.4
KOG0383 696 consensus Predicted helicase [General function pre 97.3
KOG1244336 consensus Predicted transcription factor Requiem/N 97.29
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.27
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.16
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 96.76
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.72
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 96.37
COG5141 669 PHD zinc finger-containing protein [General functi 95.73
KOG0957 707 consensus PHD finger protein [General function pre 94.4
KOG0957 707 consensus PHD finger protein [General function pre 93.17
KOG1844 508 consensus PHD Zn-finger proteins [General function 92.78
KOG2752 345 consensus Uncharacterized conserved protein, conta 92.54
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 91.58
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 89.74
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 88.75
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 86.88
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information 
Probab=100.00  E-value=2e-38  Score=276.26  Aligned_cols=227  Identities=29%  Similarity=0.434  Sum_probs=156.9

Q ss_pred             HHHHhhh-ccCChHHHHHHHHH--hHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCChhhhhhHHHHHHHHHHHHHH
Q 025765            8 FLLTFMD-IFFPPLVRDAQMQC--FFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRI   84 (248)
Q Consensus         8 yle~fie-~~~lP~EL~r~~~~--elD~~~qel~~~~~~~~~~~l~~~~k~~~~gs~~~~~k~~~l~~~I~~~~~~~~~l   84 (248)
                      -|++|++ +.|+|++..+.|++  ++|.++.++++.+.+...  |.+++.  ++|++..++.+..|.+.|++.|-.+..+
T Consensus         6 ~Lnd~~d~l~n~P~et~~~~t~l~~iD~k~~d~~k~l~q~~s--i~k~~~--~~~~~t~~e~ed~l~k~i~Ell~~a~~~   81 (271)
T COG5034           6 GLNDITDHLANVPSETDIRFTELSEIDAKVCDIIKNLRQMIS--ILKKII--DLDSQTYEEVEDGLLKEIRELLLKAIYI   81 (271)
T ss_pred             HHHHHHHHHHhCChhhhhhhhhhhhhhHHHHHHHHHHHHHHH--HHHHHh--hcccCccccchhHHHHHHHHHHHHHHHH
Confidence            4899999 99999999999999  999999999999999888  555777  8999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----Hhhccccccc--cCCCCCCC--------CCCCCCCCCCCCCCC
Q 025765           85 ADEKVALAVQAYDLVDTHIQQLDQYLKNFDEE-----LRRERDSVAT--TASPAPSL--------DGSTKSGRSSEGGRG  149 (248)
Q Consensus        85 ~dEKv~lA~~~~~lvd~hir~LD~dl~~~e~e-----l~~~~~~~~~--~~~~~~~~--------~~~~~~~~~~~~~~~  149 (248)
                      +.+|+.||+.+..++++|+++||..+++...+     ++........  .++..++.        ++++..|+..  ...
T Consensus        82 ~~~~~~l~d~~~~l~~Rh~~~~d~~~a~~~h~~~~~~ie~~~~~~s~~~~~~~ss~a~~ss~~~~saassqgs~~--t~~  159 (271)
T COG5034          82 QKEKSDLADRAEKLLRRHRKLLDDRIAKRPHEKVAARIENCHDAVSRLERNSYSSAARRSSGEHRSAASSQGSRH--TKL  159 (271)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhHHHhhhhhhhhhhhhhhhhhhhhhhccccchhhhccccccccccccccccC--chh
Confidence            99999999999999999999999999776655     2221111100  00000000        0000011100  000


Q ss_pred             CCcc-h-----hhhhHHHH--------------HHHHhhhhccCCCCCCCCCCCCCCCCCCCCceeeeCCCCCCCceecC
Q 025765          150 GRKK-T-----RLATAAAA--------------AAAAVTEAAATPVANPTGMELDLPVDPNEPTYCVCNQVSYGEMVACD  209 (248)
Q Consensus       150 ~rk~-~-----~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~C~~~~~g~mi~Cd  209 (248)
                      ++++ .     +.+...+.              ....+.++.. ....+...-+..+...++.+||+|++++||+||+||
T Consensus       160 ~~R~n~~~~k~~~p~~~S~r~~~~t~~sp~v~~t~t~v~e~~~-~~s~~~~~vss~d~se~e~lYCfCqqvSyGqMVaCD  238 (271)
T COG5034         160 KKRKNIHNLKRRSPELSSKREVSFTLESPSVPDTATRVKEGNN-GGSTKSRGVSSEDNSEGEELYCFCQQVSYGQMVACD  238 (271)
T ss_pred             HHHHhhcccccCCcchhhhccCCccCCCCCcccchhhhhcccC-CCCccccCcCccccccCceeEEEecccccccceecC
Confidence            0000 0     00000000              0000000000 001111112223444678999999999999999999


Q ss_pred             CCCCCCcceecccCCCCcCCCCceeCCCCccc
Q 025765          210 NPNCKIEWFHFGCVGLKEQPKGKWYCPDCAAL  241 (248)
Q Consensus       210 ~~~C~~~WfH~~Cvgl~~~p~~~w~C~~C~~~  241 (248)
                      |.||++||||+.||||..+|+|+|||+.|...
T Consensus       239 n~nCkrEWFH~~CVGLk~pPKG~WYC~eCk~~  270 (271)
T COG5034         239 NANCKREWFHLECVGLKEPPKGKWYCPECKKA  270 (271)
T ss_pred             CCCCchhheeccccccCCCCCCcEeCHHhHhc
Confidence            99999999999999999999999999999753

>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF12998 ING: Inhibitor of growth proteins N-terminal histone-binding; InterPro: IPR024610 Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1844 consensus PHD Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
1wen_A71 Solution Structure Of Phd Domain In Ing1-Like Prote 4e-26
2qic_A62 Crystal Structure Of The Ing1 Phd Finger In Complex 5e-25
1weu_A91 Solution Structure Of Phd Domain In Ing1-Like Prote 1e-24
2k1j_A63 Plan Homeodomain Finger Of Tumour Supressor Ing4 Le 3e-24
2vnf_A60 Molecular Basis Of Histone H3k4me3 Recognition By I 8e-24
2m1r_A63 Phd Domain Of Ing4 N214d Mutant Length = 63 1e-23
1wes_A71 Solution Structure Of Phd Domain In Inhibitor Of Gr 1e-23
1x4i_A70 Solution Structure Of Phd Domain In Inhibitor Of Gr 1e-23
2g6q_A62 Crystal Structure Of Ing2 Phd Domain In Complex Wit 3e-22
2pnx_A55 The Phd Finger Of Ing4 In Complex With An H3k4me3 H 2e-21
3c6w_A59 Crystal Structure Of The Ing5 Phd Finger In Complex 7e-19
2jmi_A90 Nmr Solution Structure Of Phd Finger Fragment Of Ye 1e-17
>pdb|1WEN|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25079 Length = 71 Back     alignment and structure 
Iteration: 1

 Score =  114 bits (286), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/61 (68%), Positives = 52/61 (85%)
Query: 179 TGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDC 238
           +G   D+PVDPNEPTYC+C+QVSYGEM+ CDNP+C IEWFHF CVGL  +P+GKW+CP C
Sbjct: 3   SGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRC 62
Query: 239 A 239
           +
Sbjct: 63  S 63
>pdb|2QIC|A Chain A, Crystal Structure Of The Ing1 Phd Finger In Complex With A Histone H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|1WEU|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25009 Length = 91 Back     alignment and structure
>pdb|2K1J|A Chain A, Plan Homeodomain Finger Of Tumour Supressor Ing4 Length = 63 Back     alignment and structure
>pdb|2VNF|A Chain A, Molecular Basis Of Histone H3k4me3 Recognition By Ing4 Length = 60 Back     alignment and structure
>pdb|2M1R|A Chain A, Phd Domain Of Ing4 N214d Mutant Length = 63 Back     alignment and structure
>pdb|1WES|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Family, Member 1-Like Length = 71 Back     alignment and structure
>pdb|1X4I|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Protein 3 (Ing3) Length = 70 Back     alignment and structure
>pdb|2G6Q|A Chain A, Crystal Structure Of Ing2 Phd Domain In Complex With H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|2PNX|A Chain A, The Phd Finger Of Ing4 In Complex With An H3k4me3 Histone Peptide Length = 55 Back     alignment and structure
>pdb|3C6W|A Chain A, Crystal Structure Of The Ing5 Phd Finger In Complex With H3k4me3 Peptide Length = 59 Back     alignment and structure
>pdb|2JMI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Yeast Yng1 Protein In Free State Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
1x4i_A70 Inhibitor of growth protein 3; structural genomics 5e-34
1weu_A91 Inhibitor of growth family, member 4; structural g 5e-33
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 1e-32
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 4e-32
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 1e-30
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 5e-30
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 3e-29
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-19
1wem_A76 Death associated transcription factor 1; structura 1e-14
1wew_A78 DNA-binding family protein; structural genomics, P 8e-14
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 1e-11
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 1e-11
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 2e-11
3o70_A68 PHD finger protein 13; PHF13, structural genomics 4e-11
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 3e-10
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 2e-09
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 3e-09
3kv5_D 488 JMJC domain-containing histone demethylation prote 4e-09
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 9e-08
1we9_A64 PHD finger family protein; structural genomics, PH 3e-07
1wee_A72 PHD finger family protein; structural genomics, PH 4e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-06
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 3e-06
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 3e-06
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 6e-06
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 6e-06
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 7e-06
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 9e-06
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 1e-05
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 2e-05
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 4e-05
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-04
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-04
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 4e-04
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 7e-04
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
 Score =  116 bits (292), Expect = 5e-34
 Identities = 40/61 (65%), Positives = 43/61 (70%)

Query: 188 DPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNRRKG 247
                 YC+CNQVSYGEMV CDN +C IEWFH+GCVGL E PKGKWYCP C A   RR  
Sbjct: 2   SSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGS 61

Query: 248 R 248
           R
Sbjct: 62  R 62
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Length = 104 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 99.92
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.88
1weu_A91 Inhibitor of growth family, member 4; structural g 99.87
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.86
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.84
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.84
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.83
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.83
1wew_A78 DNA-binding family protein; structural genomics, P 99.7
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.58
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.55
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.49
1wem_A76 Death associated transcription factor 1; structura 99.48
1we9_A64 PHD finger family protein; structural genomics, PH 99.48
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.47
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.46
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.45
1wee_A72 PHD finger family protein; structural genomics, PH 99.44
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.28
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.27
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.27
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.26
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.26
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.24
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.23
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.21
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.2
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.17
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.16
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.15
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.14
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.13
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.12
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.1
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.08
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.06
2yt5_A66 Metal-response element-binding transcription facto 98.98
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.96
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.91
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.85
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.81
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.72
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.68
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.57
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.56
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.56
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.3
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 98.22
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.05
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.03
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.01
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.99
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 97.94
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.87
3rsn_A 177 SET1/ASH2 histone methyltransferase complex subun; 97.18
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 96.95
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.61
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 93.59
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 92.81
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 92.31
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 88.0
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 80.23
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=2e-25  Score=172.78  Aligned_cols=99  Identities=21%  Similarity=0.357  Sum_probs=91.6

Q ss_pred             HHHHHHhhh-ccCChHHHHHHHHH--hHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCChhhhhhHHHHHHHHHHHH
Q 025765            6 QVFLLTFMD-IFFPPLVRDAQMQC--FFVHTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSI   82 (248)
Q Consensus         6 ~~yle~fie-~~~lP~EL~r~~~~--elD~~~qel~~~~~~~~~~~l~~~~k~~~~gs~~~~~k~~~l~~~I~~~~~~~~   82 (248)
                      .+|||+||+ +++||.||+|+|++  |+|.+++++++++++....|+    +  ++|+++++++...+ ..|++.|.+++
T Consensus         3 ~~yledyld~ie~LP~El~r~~~~irelD~~~~~~~~~i~~~~~~~~----~--~~~~~~~~~r~~~l-~~I~~~~~~~~   75 (104)
T 4afl_A            3 GMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYM----S--SARSLSSEEKLALL-KQIQEAYGKCK   75 (104)
T ss_dssp             CHHHHHHHHSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----T--CCSCCCHHHHHHHH-HHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----H--HCCCCChhhhHHHH-HHHHHHHHHHH
Confidence            489999999 99999999999999  999999999999988777654    4  78999999998888 79999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025765           83 RIADEKVALAVQAYDLVDTHIQQLDQYLK  111 (248)
Q Consensus        83 ~l~dEKv~lA~~~~~lvd~hir~LD~dl~  111 (248)
                      +++||||+||++||+||++|++|||.||+
T Consensus        76 ~l~dEKv~lA~~~~dlvdkhirrLD~dla  104 (104)
T 4afl_A           76 EFGDDKVQLAMQTYEMVDKHIRRLDTDLA  104 (104)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhcC
Confidence            99999999999999999999999999874
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 1e-27
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 1e-24
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 5e-19
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-14
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 2e-12
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 3e-12
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-10
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 6e-08
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 9e-06
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 9e-06
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 98.9 bits (246), Expect = 1e-27
 Identities = 41/69 (59%), Positives = 47/69 (68%)

Query: 179 TGMELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDC 238
           +G   +  +DPNEPTYC+CNQVSYGEM+ CDN  C IEWFHF CV L  +PKGKWYCP C
Sbjct: 3   SGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKC 62

Query: 239 AALKNRRKG 247
                   G
Sbjct: 63  RGDSGPSSG 71
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.76
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.72
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.41
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.35
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.32
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.17
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.1
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.08
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 99.03
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.98
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.9
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 92.09
d2v89a174 V(D)J recombination-activating protein 2, Rag2 {Mo 86.42
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 80.38
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.76  E-value=2.1e-19  Score=128.27  Aligned_cols=64  Identities=61%  Similarity=1.371  Sum_probs=56.3

Q ss_pred             CCCCCCCCCCCCceeeeCCCCCCCceecCCCCCCCcceecccCCCCcCCCCceeCCCCcccccc
Q 025765          181 MELDLPVDPNEPTYCVCNQVSYGEMVACDNPNCKIEWFHFGCVGLKEQPKGKWYCPDCAALKNR  244 (248)
Q Consensus       181 ~~~~~~~~~~~~~~C~C~~~~~g~mi~Cd~~~C~~~WfH~~Cvgl~~~p~~~w~C~~C~~~~~~  244 (248)
                      ...+.+.|+++.+||||+++.+++||.|++++|++.|||+.||||+..|.++||||.|+....+
T Consensus         5 ss~~~~~d~~e~~~CiC~~~~~~~~i~c~~~~C~~~wfH~~Cvgl~~~p~~~w~C~~C~~~~gp   68 (71)
T d1wesa_           5 SSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGP   68 (71)
T ss_dssp             CSCCSCCCSSSCCCSTTCCCCCSSEECCSCTTCSCCCEETTTTTCSSCCSSCCCCTTTSSCCSC
T ss_pred             cCCCCCcCCCCCCEEEeCCCCCCCEEEEECCCCCCcCccCccCCCCcCCCCcEECcCCccccCc
Confidence            4456778999999999999988999999887787689999999999999999999999876544
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2v89a1 g.50.1.2 (A:1414-1487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure