Citrus Sinensis ID: 025767

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MILTKQYRCVHSASCQCTKGHLSEDVIFLVFQHMNWNPKTIAALSCTCKWFDDLAKRVLWKEFCRTRAPKMMVDLQSSGSHSVDGNWRALGKLLIYCSGCKKGGLFNSIQIPGHFVNKTRFSRTSGKSFLLPQCRTDVLYVSDPCEHLDQGEEGDVGFFRGVFKSFQMSKVRKMLIKRGAQLHPTEACPYCKAKLWSMLQAKMIPQSASCRLGAYEDCIEYYVCLNGHMLGICSLLPLSDSEEVSEPE
cccccEEEEEcccccccccccccHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccCEEEcccccccccccccccEEEEEcccccccccccccEEEEEccccccHHHHHHHHHHHcccccccccccccccccccHHHHccccccccccccccccccEEEEEEEccCEEEEEEECcccccccccccc
*I*TKQYRCVHSASCQCTKGHLSEDVIFLVFQHMNWNPKTIAALSCTCKWFDDLAKRVLWKEFCRTRAPKMMVDLQ****HSVDGNWRALGKLLIYCSGCKKGGLFNSIQIPGHFVNKTRFSRTSGKSFLLPQCRTDVLYVSDPCEHLDQGEEGDVGFFRGVFKSFQMSKVRKMLIKRGAQLHPTEACPYCKAKLWSMLQAKMIPQSASCRLGAYEDCIEYYVCLNGHMLGICSLLP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILTKQYRCVHSASCQCTKGHLSEDVIFLVFQHMNWNPKTIAALSCTCKWFDDLAKRVLWKEFCRTRAPKMMVDLQSSGSHSVDGNWRALGKLLIYCSGCKKGGLFNSIQIPGHFVNKTRFSRTSGKSFLLPQCRTDVLYVSDPCEHLDQGEEGDVGFFRGVFKSFQMSKVRKMLIKRGAQLHPTEACPYCKAKLWSMLQAKMIPQSASCRLGAYEDCIEYYVCLNGHMLGICSLLPLSDSEEVSEPE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
EID1-like F-box protein 2 confidentQ9FLZ8
EID1-like F-box protein 1 probableQ9LF38

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L2O, chain B
Confidence level:confident
Coverage over the Query: 21-69
View the alignment between query and template
View the model in PyMOL
Template: 2E31, chain A
Confidence level:probable
Coverage over the Query: 18-93
View the alignment between query and template
View the model in PyMOL