Citrus Sinensis ID: 025797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGLSRER
cccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccHHHHcccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccccccccEEEEccccEEEccEEEEEEEcccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEcccccccccEEEEEccccccccccccEEEcccccccEEEcc
cccHHHHcccccccccccccccccccccHHHHHcccHHHHcccccccccccccccccccccHHHHEEccccccccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHcccccccccccEEEEEccEEEEccEEEEEEccccHHHccHHHHcccEEEEccccccEHHHHcHHHHccccEEEEccccEcccEccccccHHHccccccEEEEEcccccccHHHccc
mashsalapsripaitripsktthsfptqcstkrLDVAEFAGlranagatyatgardasffDAVTAqltpkvaagsvpvkKETVAKLKVAINGFGrigrnflrcwhgrkdspldVVVVNdsggvknashLLKYDSLlgtfkadvkivdnetisvdgklikvvsnrdplqlpwaelgIDIViegtgvfvdgpgagkhiQAGAKKVIItapakgadiptyvvgvnekdydHEVANIVRSWMknwglsrer
mashsalapsripaitripsktthsfptqcstKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLtpkvaagsvpvkketVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVkivdnetisvdgklikvvsnrdplqlpWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRswmknwglsrer
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGLSRER
*****************************CSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGL****
***********************************************************************************VAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGLS***
*********SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGLSRER
************************************************************FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGLSR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWMKNWGLSRER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
P12859 451 Glyceraldehyde-3-phosphat N/A no 0.943 0.518 0.787 1e-106
P25857 447 Glyceraldehyde-3-phosphat yes no 0.923 0.512 0.792 1e-105
P12860 451 Glyceraldehyde-3-phosphat N/A no 0.931 0.512 0.797 1e-104
P09044 438 Glyceraldehyde-3-phosphat N/A no 0.818 0.463 0.834 6e-96
P50362 374 Glyceraldehyde-3-phosphat N/A no 0.637 0.422 0.743 2e-64
P09315 403 Glyceraldehyde-3-phosphat N/A no 0.766 0.471 0.663 5e-64
P19866 401 Glyceraldehyde-3-phosphat N/A no 0.758 0.468 0.661 6e-64
P25856 396 Glyceraldehyde-3-phosphat no no 0.762 0.477 0.664 2e-63
P09043 392 Glyceraldehyde-3-phosphat N/A no 0.754 0.477 0.643 5e-62
P12858 405 Glyceraldehyde-3-phosphat N/A no 0.758 0.464 0.637 3e-61
>sp|P12859|G3PB_PEA Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2 Back     alignment and function desciption
 Score =  385 bits (989), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/235 (78%), Positives = 213/235 (90%), Gaps = 1/235 (0%)

Query: 1   MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASF 60
           MA+H+ALA +RIP  TR PSKT+HSFP+QC++KRL+V EF+GL++ +  +Y   ARD+SF
Sbjct: 1   MATHAALASTRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSF 60

Query: 61  FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND 120
           +D V AQLT K A GS  VK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVND
Sbjct: 61  YDVVAAQLTSK-ANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND 119

Query: 121 SGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIV 180
           SGGVKNASHLLKYDS+LGTFKA+VKI++NETI+VDGK IKVVS+RDPL+LPWAELGIDIV
Sbjct: 120 SGGVKNASHLLKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIV 179

Query: 181 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIV 235
           IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV+GVNE+DY HEVA+I+
Sbjct: 180 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADII 234





Pisum sativum (taxid: 3888)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 3
>sp|P25857|G3PB_ARATH Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2 Back     alignment and function description
>sp|P12860|G3PB_SPIOL Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1 Back     alignment and function description
>sp|P09044|G3PB_TOBAC Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1 Back     alignment and function description
>sp|P50362|G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1 Back     alignment and function description
>sp|P09315|G3PA_MAIZE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1 Back     alignment and function description
>sp|P19866|G3PA_SPIOL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2 Back     alignment and function description
>sp|P25856|G3PA_ARATH Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3 Back     alignment and function description
>sp|P09043|G3PA_TOBAC Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1 Back     alignment and function description
>sp|P12858|G3PA_PEA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
255539282 458 glyceraldehyde 3-phosphate dehydrogenase 0.943 0.510 0.859 1e-114
224086078 452 predicted protein [Populus trichocarpa] 0.943 0.517 0.846 1e-111
381393062 452 glyceraldehyde-3-phosphate dehydrogenase 0.943 0.517 0.825 1e-109
358248146 451 uncharacterized protein LOC100806482 [Gl 0.943 0.518 0.812 1e-109
327198779 450 glyceraldehyde-3-phosphate dehydrogenase 0.939 0.517 0.821 1e-108
351726690 451 glyceraldehyde-3-phosphate dehydrogenase 0.943 0.518 0.808 1e-108
224061855 440 predicted protein [Populus trichocarpa] 0.899 0.506 0.861 1e-108
255641007 452 unknown [Glycine max] 0.947 0.519 0.795 1e-108
449455619 451 PREDICTED: glyceraldehyde-3-phosphate de 0.939 0.516 0.834 1e-107
147795191 453 hypothetical protein VITISV_021576 [Viti 0.943 0.516 0.826 1e-107
>gi|255539282|ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223551407|gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/235 (85%), Positives = 217/235 (92%), Gaps = 1/235 (0%)

Query: 1   MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASF 60
           MA+H+ALAPSRIPA TR+PSK+ HSFPTQCS+KRL+VAEF+GLRA++  TYA  A +ASF
Sbjct: 1   MATHAALAPSRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASF 60

Query: 61  FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND 120
           FD V AQ+ PKVA  S P + ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+VVND
Sbjct: 61  FDLVAAQMAPKVAT-STPTRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND 119

Query: 121 SGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIV 180
           SGGVKNASHLLKYDS+LGTFKADVKIVDN TISVDGK IKVVSNRDPL+LPWAELGIDIV
Sbjct: 120 SGGVKNASHLLKYDSMLGTFKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIV 179

Query: 181 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIV 235
           IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDY HEVANIV
Sbjct: 180 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIV 234




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224086078|ref|XP_002307806.1| predicted protein [Populus trichocarpa] gi|222857255|gb|EEE94802.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|381393062|gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri] Back     alignment and taxonomy information
>gi|358248146|ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max] gi|255636463|gb|ACU18570.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|327198779|emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|351726690|ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] gi|77540212|gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] Back     alignment and taxonomy information
>gi|224061855|ref|XP_002300632.1| predicted protein [Populus trichocarpa] gi|222842358|gb|EEE79905.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255641007|gb|ACU20783.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449455619|ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] gi|449485095|ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147795191|emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2009864 447 GAPB "glyceraldehyde-3-phospha 0.923 0.512 0.796 4.7e-96
TAIR|locus:2010361 399 GAPA-2 "glyceraldehyde 3-phosp 0.770 0.478 0.652 1e-61
TAIR|locus:2090802 396 GAPA "glyceraldehyde 3-phospha 0.762 0.477 0.664 1.2e-60
UNIPROTKB|Q829W3 335 gap2 "Glyceraldehyde-3-phospha 0.588 0.435 0.510 3.6e-34
TAIR|locus:2032810 420 GAPCP-2 "glyceraldehyde-3-phos 0.854 0.504 0.4 4.1e-33
TIGR_CMR|CHY_0280 335 CHY_0280 "glyceraldehyde-3-pho 0.576 0.426 0.516 8.5e-33
TAIR|locus:2206435 422 GAPCP-1 "glyceraldehyde-3-phos 0.870 0.511 0.394 1.1e-32
TIGR_CMR|BA_5369 334 BA_5369 "glyceraldehyde 3-phos 0.580 0.431 0.479 4.2e-31
UNIPROTKB|Q82IZ2 334 gap1 "Glyceraldehyde-3-phospha 0.588 0.437 0.469 5.4e-31
CGD|CAL0005657 335 TDH3 [Candida albicans (taxid: 0.548 0.405 0.521 1.8e-30
TAIR|locus:2009864 GAPB "glyceraldehyde-3-phosphate dehydrogenase B subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 955 (341.2 bits), Expect = 4.7e-96, P = 4.7e-96
 Identities = 188/236 (79%), Positives = 209/236 (88%)

Query:     1 MASHSALAPSRIPAITRIPSKTT-HSFPTQCSTKRLDVAEFAGLRANAGATYATGARDAS 59
             MA+H+ALA SRIP   R+ SK+  HSFP QCS+KRL+VAEF+GLR ++      G  +AS
Sbjct:     1 MATHAALAVSRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS-----IGG-EAS 54

Query:    60 FFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVN 119
             FFDAV AQ+ PK    S PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VVV+N
Sbjct:    55 FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLN 114

Query:   120 DSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDI 179
             DSGGVKNASHLLKYDS+LGTFKA+VKIVDNETISVDGKLIKVVSNRDPL+LPWAELGIDI
Sbjct:   115 DSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDI 174

Query:   180 VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIV 235
             VIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GVNE+DY H+VANI+
Sbjct:   175 VIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANII 230




GO:0000166 "nucleotide binding" evidence=IEA
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0047100 "glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity" evidence=ISS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IEP;RCA
GO:0009744 "response to sucrose stimulus" evidence=IEP;RCA
GO:0019253 "reductive pentose-phosphate cycle" evidence=NAS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=NAS
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0010319 "stromule" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0015994 "chlorophyll metabolic process" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0019216 "regulation of lipid metabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0031408 "oxylipin biosynthetic process" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2010361 GAPA-2 "glyceraldehyde 3-phosphate dehydrogenase A subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090802 GAPA "glyceraldehyde 3-phosphate dehydrogenase A subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q829W3 gap2 "Glyceraldehyde-3-phosphate dehydrogenase" [Streptomyces avermitilis MA-4680 (taxid:227882)] Back     alignment and assigned GO terms
TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0280 CHY_0280 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5369 BA_5369 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q82IZ2 gap1 "Glyceraldehyde-3-phosphate dehydrogenase" [Streptomyces avermitilis MA-4680 (taxid:227882)] Back     alignment and assigned GO terms
CGD|CAL0005657 TDH3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P25857G3PB_ARATH1, ., 2, ., 1, ., 1, 30.79230.92330.5123yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_V0707
SubName- Full=Putative uncharacterized protein; (453 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00080776
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (402 aa)
     0.940
grail3.0154005402
phosphoglycerate kinase (EC-2.7.7.2 2.7.2.3) (402 aa)
     0.940
estExt_fgenesh4_pm.C_LG_VIII0335
phosphoglycerate kinase (481 aa)
     0.932
estExt_fgenesh4_pm.C_LG_X0655
phosphoglycerate kinase (481 aa)
     0.932
grail3.0049021504
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (254 aa)
     0.913
estExt_fgenesh4_pg.C_LG_I1744
triose-phosphate isomerase (EC-5.3.1.1) (255 aa)
     0.913
estExt_Genewise1_v1.C_LG_IV0988
hypothetical protein (256 aa)
     0.913
estExt_Genewise1_v1.C_LG_X2172
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (256 aa)
     0.913
estExt_Genewise1_v1.C_LG_XIV0740
transketolase (EC-2.2.1.1) (635 aa)
      0.908
eugene3.00091331
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (264 aa)
    0.908

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
PLN02237 442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 1e-137
PLN03096 395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 5e-97
PRK07403 337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 8e-68
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 4e-65
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 3e-60
TIGR01534 326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 3e-55
COG0057 335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 7e-52
PRK07729 343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 1e-51
PLN02272 421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 3e-42
PRK13535 336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 7e-33
PTZ00023 337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 4e-32
PRK15425 331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 2e-29
PLN02358 338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 3e-28
TIGR01532 325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 4e-28
PTZ00434 361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 3e-27
PRK08955 334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 1e-22
PRK08289 477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 1e-22
PTZ00353 342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 4e-10
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
 Score =  392 bits (1008), Expect = e-137
 Identities = 194/233 (83%), Positives = 209/233 (89%), Gaps = 9/233 (3%)

Query: 3   SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFD 62
           +H+ALA SRIPA TR+PSK +H        KRL+VAEF+GLRA++  T+A  AR+ASFFD
Sbjct: 1   THAALASSRIPATTRLPSKASH--------KRLEVAEFSGLRASSCVTFAKNAREASFFD 52

Query: 63  AVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 122
            V +QL PK  AGS PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG
Sbjct: 53  VVASQLAPK-VAGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 111

Query: 123 GVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIE 182
           GVKNASHLLKYDS+LGTFKADVKIVD+ETISVDGK IKVVSNRDPL+LPWAELGIDIVIE
Sbjct: 112 GVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVVSNRDPLKLPWAELGIDIVIE 171

Query: 183 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIV 235
           GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNE DYDHEVANIV
Sbjct: 172 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIV 224


Length = 442

>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
KOG0657 285 consensus Glyceraldehyde 3-phosphate dehydrogenase 100.0
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 99.96
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 99.85
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 98.84
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 98.46
PRK08300 302 acetaldehyde dehydrogenase; Validated 97.55
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 97.42
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 97.41
TIGR00036 266 dapB dihydrodipicolinate reductase. 97.23
PRK13303 265 L-aspartate dehydrogenase; Provisional 97.18
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.93
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.9
PRK06270 341 homoserine dehydrogenase; Provisional 96.9
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 96.89
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 96.84
PRK06813 346 homoserine dehydrogenase; Validated 96.63
PRK13304 265 L-aspartate dehydrogenase; Reviewed 96.44
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 96.39
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.33
PRK06392 326 homoserine dehydrogenase; Provisional 96.06
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 95.86
PRK00048257 dihydrodipicolinate reductase; Provisional 95.78
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 95.59
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.48
PRK06901 322 aspartate-semialdehyde dehydrogenase; Provisional 95.12
PRK06349 426 homoserine dehydrogenase; Provisional 94.94
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 94.74
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 94.53
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 94.49
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.24
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 94.12
PRK11579 346 putative oxidoreductase; Provisional 93.97
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 93.81
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 93.7
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 93.31
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 92.86
PLN02477410 glutamate dehydrogenase 92.15
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 91.83
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 91.67
PRK06487317 glycerate dehydrogenase; Provisional 91.49
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 91.39
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 90.84
PRK06932314 glycerate dehydrogenase; Provisional 90.67
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 89.92
PRK08374 336 homoserine dehydrogenase; Provisional 89.82
PLN02928347 oxidoreductase family protein 89.78
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 89.67
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 89.65
COG2344211 AT-rich DNA-binding protein [General function pred 89.32
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 89.21
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 89.13
PRK06436303 glycerate dehydrogenase; Provisional 89.08
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 88.85
PRK07574385 formate dehydrogenase; Provisional 88.67
PRK13243333 glyoxylate reductase; Reviewed 88.4
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 88.31
PRK10206 344 putative oxidoreductase; Provisional 88.0
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 87.64
PLN02306386 hydroxypyruvate reductase 87.37
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 87.08
PLN02775 286 Probable dihydrodipicolinate reductase 86.65
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 86.49
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 86.38
PLN02383 344 aspartate semialdehyde dehydrogenase 86.23
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 84.9
PRK12480330 D-lactate dehydrogenase; Provisional 84.88
PRK14030445 glutamate dehydrogenase; Provisional 84.77
COG3804 350 Uncharacterized conserved protein related to dihyd 84.73
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 84.57
PLN03139386 formate dehydrogenase; Provisional 84.43
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 83.99
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 83.61
PLN02256 304 arogenate dehydrogenase 83.48
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 82.94
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 82.83
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 82.23
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 82.11
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 81.73
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 81.51
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 81.32
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 80.52
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
Probab=100.00  E-value=1.7e-66  Score=498.01  Aligned_cols=231  Identities=85%  Similarity=1.273  Sum_probs=210.3

Q ss_pred             ccCCCCCCCCCCccccCCCCcCCCCCcccccccccccccCcccccccccccccCCcCHHHHHHhhccccccCCCCCcccc
Q 025797            3 SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKE   82 (248)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (248)
                      +|||||++|||+++|+||+++|        ++.+|++|+|||++++++|.....+.+|.+.++.++..+.. .....+.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~   71 (442)
T PLN02237          1 THAALASSRIPATTRLPSKASH--------KRLEVAEFSGLRASSCVTFAKNAREASFFDVVASQLAPKVA-GSTPVRGE   71 (442)
T ss_pred             CcchhcccCCcccccccccccc--------ccccccccccccccccccccccccchhHHHHhhhhhhhhhc-cccccccc
Confidence            6999999999999999999862        66789999999999999998777788999999999987633 34566677


Q ss_pred             ccceeeEEEeCCChhhHHHHHHHhhCCCCCeEEEEEeCCCChhhhhhhccccCcCcccCceEEEecCCcEEECCeEEEEE
Q 025797           83 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVV  162 (248)
Q Consensus        83 ~~~~vkV~INGFGRIGRlvlR~~~~~~~~~l~iVaIND~~~~e~~ayLLkYDStHGkf~g~V~v~e~~~L~inGk~I~v~  162 (248)
                      +.|++||||||||||||+++|+++++.+++++||+|||..++++++|||||||+||+|+++|++.+++.|.+||++|+|+
T Consensus        72 ~~~~ikVgINGFGRIGR~vlR~~~~~~~~~ievVaINd~~~~~~~ayLlkyDS~hG~f~~~v~~~~~~~L~v~Gk~I~V~  151 (442)
T PLN02237         72 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVV  151 (442)
T ss_pred             ccceEEEEEECCChHHHHHHHHHHHccCCCeEEEEECCCCCHHHHHHHHccccCCCCcCCceEECCCCEEEECCEEEEEE
Confidence            88999999999999999999999875445799999999999999999999999999999999864678999999999999


Q ss_pred             ecCCCCCCCCCCCcccEEecCcccccCchhhhHHHHcCCCEEEEcCCCCCCCCCeEEeecCCCCCCCCCCeEEeecC--C
Q 025797          163 SNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWM--K  240 (248)
Q Consensus       163 ~~~dP~~i~W~~~GidiVVE~TG~F~~~e~a~~HL~~GAKKVIISAPsk~~D~ptiV~GVN~~~y~~~~~~IISnAS--~  240 (248)
                      +++||+++||+++|+||||||||.|++++.+..||++|||||+||||.++.|+|||||||||+.|++..++||||||  +
T Consensus       152 ~~~dp~~l~W~~~gVDiViE~TG~f~s~e~a~~hl~aGAkkV~iSAP~~d~dvptvV~GVN~~~~~~~~~~IISnaSCTT  231 (442)
T PLN02237        152 SNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT  231 (442)
T ss_pred             EcCCchhCChhhcCCCEEEEccChhhhHHHHHHHHhCCCEEEEECCCCCCCCCceEecccCHHHhCcCCCCEEECCchHH
Confidence            99999999999999999999999999999999999999999999999987568999999999999864368999999  8


Q ss_pred             cc
Q 025797          241 NW  242 (248)
Q Consensus       241 ~~  242 (248)
                      ||
T Consensus       232 Nc  233 (442)
T PLN02237        232 NC  233 (442)
T ss_pred             HH
Confidence            87



>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2pkq_O 368 Crystal Structure Of The Photosynthetic A2b2-Glycer 1e-78
1nbo_O 337 The Dual Coenzyme Specificity Of Photosynthetic Gly 3e-64
1rm5_O 337 Crystal Structure Of Mutant S188a Of Photosynthetic 3e-64
1rm3_O 337 Crystal Structure Of Mutant T33a Of Photosynthetic 4e-64
2pkr_O 365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 4e-64
3k2b_A 337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 6e-62
1jn0_O 335 Crystal Structure Of The Non-Regulatory A4 Isoform 3e-60
3b1j_A 339 Crystal Structure Of Dehydrogenese Length = 339 5e-49
2d2i_A 380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 3e-48
2ep7_A 342 Structural Study Of Project Id Aq_1065 From Aquifex 1e-38
3dbv_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 9e-34
1hdg_O 332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 1e-33
2g82_O 331 High Resolution Structures Of Thermus Aquaticus Gly 5e-33
1cer_O 331 Determinants Of Enzyme Thermostability Observed In 6e-33
1vc2_A 331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 1e-32
1nq5_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-31
1npt_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-31
1gd1_O 334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 1e-31
3l0d_A 356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 2e-31
1dbv_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-30
4dib_A 345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 1e-30
3hja_A 356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 8e-30
2i5p_O 342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-29
3gnq_A 344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-29
3doc_A 335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 3e-28
1obf_O 335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 4e-28
1vsu_A 359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 4e-27
3cif_A 359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 5e-27
3cps_A 354 Crystal Structure Of Cryptosporidium Parvum Glycera 8e-27
3hq4_R 336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 2e-26
3ksd_Q 336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 2e-26
3lc1_P 336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 2e-26
3lc7_O 339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 2e-26
3k9q_Q 336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 2e-26
2vyn_A 331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-26
3vaz_P 344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 2e-26
3lvf_P 338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 2e-26
3k73_Q 336 Crystal Structure Of Phosphate Bound Holo Glycerald 2e-26
1gae_O 330 Comparison Of The Structures Of Wild Type And A N31 2e-26
1gad_O 330 Comparison Of The Structures Of Wild Type And A N31 2e-26
1s7c_A 331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 2e-26
1ywg_O 337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 7e-26
2b4r_O 345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 8e-26
4iq8_A 340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 1e-25
3pym_A 332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 1e-25
1dc4_A 330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 3e-25
3e5r_O 337 Crystal Structure And Functional Analysis Of Glycer 3e-25
3e6a_O 336 Crystal Structure And Functional Analysis Of Glycer 4e-25
1znq_O 338 Crsytal Structure Of Human Liver Gapdh Length = 338 1e-23
1u8f_O 335 Crystal Structure Of Human Placental Glyceraldehyde 1e-23
1j0x_O 332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 4e-23
1ihx_A 333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 8e-23
2x0n_A 359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 8e-23
1gyp_A 358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 1e-22
1a7k_A 360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 1e-22
3h9e_B 346 Crystal Structure Of Human Sperm-Specific Glycerald 1e-22
1gpd_G 334 Studies Of Asymmetry In The Three-Dimensional Struc 2e-22
4gpd_1 333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 2e-22
1szj_G 333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 2e-22
1dss_G 333 Structure Of Active-Site Carboxymethylated D-Glycer 2e-22
1k3t_A 359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-22
3dmt_C 359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-22
3gpd_R 334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 3e-21
2x5k_O 339 Structure Of An Active Site Mutant Of The D-Erythro 4e-21
2vyn_D 334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 4e-21
2xf8_A 338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 4e-21
2x5j_O 339 Crystal Structure Of The Apoform Of The D-Erythrose 4e-21
3sth_A 361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 6e-21
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure

Iteration: 1

Score = 288 bits (738), Expect = 1e-78, Method: Compositional matrix adjust. Identities = 138/152 (90%), Positives = 148/152 (97%) Query: 86 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVK+A+HLLKYDS+LGTFKADVK Sbjct: 1 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVK 60 Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205 I+DNET S+DGK IKVVSNRDPL+LPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI Sbjct: 61 IIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 120 Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIVRS 237 ITAPAKG+DIPTYVVGVNEKDY H+VANI+ + Sbjct: 121 ITAPAKGSDIPTYVVGVNEKDYGHDVANIISN 152
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 3e-85
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 6e-85
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 1e-83
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 1e-79
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 1e-79
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 1e-79
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 5e-79
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 6e-79
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 2e-78
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 8e-76
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 1e-75
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 9e-74
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 4e-66
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 8e-61
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 6e-60
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 1e-58
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 3e-58
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 3e-58
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 2e-57
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 3e-57
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 3e-56
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 3e-37
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 2e-36
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 2e-33
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 8e-24
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
 Score =  256 bits (656), Expect = 3e-85
 Identities = 86/150 (57%), Positives = 115/150 (76%), Gaps = 1/150 (0%)

Query: 86  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145
            ++VAINGFGRIGRNFLRCW GR+++ L+VV +N++   + A+HLL+YDS+LG F AD+ 
Sbjct: 2   TIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADIS 61

Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205
             D  +I+V+GK +K+V +R+PL LPW E  ID+VIE TGVFV   GA KHIQAGAKKV+
Sbjct: 62  -YDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVL 120

Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIV 235
           ITAP KG  + TYV+GVN+ +Y HE   ++
Sbjct: 121 ITAPGKGEGVGTYVIGVNDSEYRHEDFAVI 150


>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 99.95
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 99.86
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 99.84
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 99.81
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 99.76
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 99.72
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 99.71
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 99.66
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 99.64
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 99.61
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 99.61
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 99.59
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 99.16
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 99.1
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 98.9
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 98.79
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 98.73
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 98.69
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 98.69
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 98.6
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 98.2
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.77
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.21
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.03
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.9
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.77
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.62
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.58
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.54
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.52
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.48
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 96.4
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 96.35
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.34
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.27
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.24
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 96.22
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.18
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.12
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.02
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.99
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.99
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 95.97
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 95.92
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 95.92
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.85
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 95.81
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 95.72
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.67
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 95.66
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.64
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 95.56
1ydw_A 362 AX110P-like protein; structural genomics, protein 95.55
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 95.2
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 95.18
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 95.09
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 95.07
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 94.96
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 94.89
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.84
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.71
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 94.55
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 94.55
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 94.53
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 94.29
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 94.02
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 93.9
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 93.77
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 93.1
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 92.85
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 92.57
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 92.51
4had_A 350 Probable oxidoreductase protein; structural genomi 92.4
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 92.21
4h3v_A 390 Oxidoreductase domain protein; structural genomics 92.16
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 91.54
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 91.46
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 91.42
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 91.32
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 91.12
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 91.11
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 90.98
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.82
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 90.8
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 90.72
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 90.71
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 90.54
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 90.52
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 89.97
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 89.97
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 89.77
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 89.73
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 89.49
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 89.31
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 89.26
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 89.17
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 89.1
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 88.73
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 88.68
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 88.64
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 88.52
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 88.51
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 88.41
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 88.31
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 88.27
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 88.2
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 88.18
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 88.17
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 87.8
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 87.79
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 87.74
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 87.74
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 87.63
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 87.24
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 86.86
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 86.84
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 86.8
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 86.55
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 86.54
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 86.52
1lss_A140 TRK system potassium uptake protein TRKA homolog; 86.51
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 86.22
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 85.85
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 85.66
2rir_A300 Dipicolinate synthase, A chain; structural genomic 85.36
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 85.08
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 85.05
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 84.93
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 84.83
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.8
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 84.33
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 84.07
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 83.87
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 83.62
1id1_A153 Putative potassium channel protein; RCK domain, E. 83.15
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 82.3
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 82.1
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 81.63
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 81.06
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 80.76
3c85_A183 Putative glutathione-regulated potassium-efflux S 80.57
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 80.14
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-57  Score=420.44  Aligned_cols=155  Identities=42%  Similarity=0.681  Sum_probs=147.8

Q ss_pred             ceeeEEEeCCChhhHHHHHHHhhCCCCCeEEEEEeCCCChhhhhhhccccCcCcccCceEEEecCCcEEECCeEEEEEec
Q 025797           85 AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSN  164 (248)
Q Consensus        85 ~~vkV~INGFGRIGRlvlR~~~~~~~~~l~iVaIND~~~~e~~ayLLkYDStHGkf~g~V~v~e~~~L~inGk~I~v~~~  164 (248)
                      |++||||||||||||+++|+++++..+++++|+|||+.|+++++||||||||||+|+++|++ ++++|++||++|+|+++
T Consensus         1 m~~kv~INGfGrIGr~v~Ra~~~~~~~~~~ivaiNd~~d~~~~a~l~kyDS~hG~f~~~v~~-~~~~l~i~Gk~I~v~~e   79 (335)
T 3doc_A            1 MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEV-AGDTIDVGYGPIKVHAV   79 (335)
T ss_dssp             CCEEEEEECCSHHHHHHHHHHHHTTCCSEEEEEEECSSCHHHHHHHHHEETTTEECSSCCEE-CSSEEESSSSEEEEECC
T ss_pred             CCEEEEEECCCcHHHHHHHHHHhccCCCeEEEEEeCCCCHHHHHHHhcccCCCCCCCCeEEE-ecCEEEECCEEEEEEee
Confidence            56899999999999999999998643579999999999999999999999999999999998 68899999999999999


Q ss_pred             CCCCCCCCCCCcccEEecCcccccCchhhhHHHHcCCCEEEEcCCCCCCCCCeEEeecCCCCCCCCCCeEEeecC--Ccc
Q 025797          165 RDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWM--KNW  242 (248)
Q Consensus       165 ~dP~~i~W~~~GidiVVE~TG~F~~~e~a~~HL~~GAKKVIISAPsk~~D~ptiV~GVN~~~y~~~~~~IISnAS--~~~  242 (248)
                      +||+++||+++|+|||+||||.|+++|+++.||++||||||||||+++ ++|||||||||++|+++ ++||||||  +||
T Consensus        80 ~dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d-~~p~vV~gVN~~~~~~~-~~IISNasCTTn~  157 (335)
T 3doc_A           80 RNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADG-ADLTVVYGVNNDKLTKD-HLVISNASCTTNC  157 (335)
T ss_dssp             SSTTSSCTTTTTCSEEEECSSSCCSHHHHTHHHHTTCSEEEESSCCTT-CSEECCTTTTGGGCCTT-CCEEECCCHHHHH
T ss_pred             cccccccccccCCCEEEEccCccCCHHHHHHHHHcCCCEEEECCCCCC-CCCEEecccCHHHhCcc-CCeEecCchhhhh
Confidence            999999999999999999999999999999999999999999999986 67999999999999987 89999999  887



>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 2e-49
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 1e-46
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 3e-43
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 8e-43
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 2e-37
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 3e-35
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 9e-34
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 1e-33
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 1e-33
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 4e-33
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 2e-31
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 7e-30
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 1e-27
d1lc0a1172 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { 0.002
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Spinach (Spinacia oleracea) [TaxId: 3562]
 Score =  158 bits (401), Expect = 2e-49
 Identities = 114/144 (79%), Positives = 128/144 (88%), Gaps = 1/144 (0%)

Query: 87  LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKI 146
           LKVAINGFGRIGRNFLRCWHGRKDSPLDVVV+ND+GGVK ASHLLKYDS+LGTF ADVK 
Sbjct: 1   LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKT 60

Query: 147 VDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVII 206
             +  ISVDGK+IKVVS+R+P+ LPW ++GID+VIEGTGVFVD  GAGKH+QAGAKKV+I
Sbjct: 61  AGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLI 120

Query: 207 TAPAKGADIPTYVVGVNEKDYDHE 230
           TAP KG DIPTYVVGVNE+ Y H 
Sbjct: 121 TAPGKG-DIPTYVVGVNEEGYTHA 143


>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.6
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.55
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 96.91
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 96.73
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.33
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.93
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.22
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 94.91
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.57
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.55
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 94.22
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 94.04
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.97
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.61
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.57
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.19
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.9
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.89
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 92.17
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.01
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 91.65
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.31
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.95
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.94
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.66
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.48
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.01
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.62
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 89.54
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 88.94
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 88.55
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 88.35
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.24
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 87.9
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 87.49
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 87.45
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 85.99
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 85.08
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 84.08
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.83
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 82.72
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 81.73
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.57
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 81.38
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 80.98
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.55
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.05
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Spinach (Spinacia oleracea) [TaxId: 3562]
Probab=100.00  E-value=2.8e-62  Score=415.65  Aligned_cols=154  Identities=75%  Similarity=1.244  Sum_probs=146.8

Q ss_pred             eeEEEeCCChhhHHHHHHHhhCCCCCeEEEEEeCCCChhhhhhhccccCcCcccCceEEEecCCcEEECCeEEEEEecCC
Q 025797           87 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRD  166 (248)
Q Consensus        87 vkV~INGFGRIGRlvlR~~~~~~~~~l~iVaIND~~~~e~~ayLLkYDStHGkf~g~V~v~e~~~L~inGk~I~v~~~~d  166 (248)
                      |||||||||||||+++|+++++.+.++++|+|||+.++++++|||||||+||+|+++++.++++.+++||++|+++++++
T Consensus         1 ikIgINGfGRIGR~v~R~~~~~~~~~i~ivaINd~~~~~~~ayLlkyDSvhG~~~~~i~~~~~~~~~ing~~I~~~~~~~   80 (172)
T d1rm4a1           1 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRN   80 (172)
T ss_dssp             EEEEEECCSHHHHHHHHHHHHCSSCSEEEEEEECTTCHHHHHHHHHCCTTTCSCSSCEEECTTSEEEETTEEEEEECCSC
T ss_pred             CEEEEECCCHHHHHHHHHHHhCCCCCEEEEEEcCCCCHHHHHHHHhcCcccccccceeEecCCcceEECCEEEEEecCCC
Confidence            68999999999999999999987778999999999999999999999999999999999866667789999999999999


Q ss_pred             CCCCCCCCCcccEEecCcccccCchhhhHHHHcCCCEEEEcCCCCCCCCCeEEeecCCCCCCCCCCeEEeecC--Ccc
Q 025797          167 PLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSWM--KNW  242 (248)
Q Consensus       167 P~~i~W~~~GidiVVE~TG~F~~~e~a~~HL~~GAKKVIISAPsk~~D~ptiV~GVN~~~y~~~~~~IISnAS--~~~  242 (248)
                      |+++||.++|+||||||||+|++++++++||++||||||||||+|+ |+|||||||||++|+++ ++||||||  +||
T Consensus        81 p~~i~W~~~gvDiViEcTG~f~~~~~~~~hl~~GakkViiSAP~k~-~~~tiV~GVN~~~~~~~-~~iIS~aSCTtn~  156 (172)
T d1rm4a1          81 PVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTHA-DTIISNASNEWGY  156 (172)
T ss_dssp             GGGSCHHHHTCCEEEECSSSCCBHHHHHHHHHTTCSCEEESSCCBS-SCCBCCTTTTGGGCCTT-CSEEECCCTTHHH
T ss_pred             hHHCChhhcCCCEEEecCceEccHHHHHHHHhcCCceEEeeccccc-ceeeEEeecchhhcCCC-CCEEEcccchhcc
Confidence            9999999999999999999999999999999999999999999997 78999999999999987 99999999  565



>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure