Citrus Sinensis ID: 025799

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQRRELNESH
cccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccEcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mvkdtayydvlgvnvdaspAEIKKAYYLKARivhpdknpgdpkaakNFQVLGEAYqvlsdpekreaydkhgkegipqdsMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYKHKIQEKMRAMQKEREEKLITILKNhlepfvdgrADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKelgkdkrymkvpFLAEWVRDKGHLIKSQVSaasgraeeaepVREQRRELNESH
mvkdtayydvlgvnvdaspaeIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHgkegipqdsmVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYKHKIQEKMRAMQKEREEKLITILKnhlepfvdGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAkelgkdkrYMKVPFLAEWVRDKGHLIKSQvsaasgraeeaepvreqrrelnesh
MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQRRELNESH
****TAYYDVLGVNVDASPAEIKKAYYLKARIVH**************QVLGEAY************************MVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEE**QDIEVYKH***************KLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLI****************************
*VKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEG**********AVFGMIFGSEYFEDYIGQLAL********************KIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGR******************
MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKS**************************
****TAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQRREL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDxxxxxxxxxxxxxxxxxxxxxKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQRRELNESH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
Q8GYX8 398 Chaperone protein dnaJ 10 no no 0.967 0.603 0.599 9e-78
P39101391 Protein CAJ1 OS=Saccharom yes no 0.979 0.621 0.331 7e-29
O59731355 Uncharacterized J domain- yes no 0.774 0.540 0.384 5e-27
P40564 432 DnaJ-like protein 1 OS=Sa no no 0.423 0.243 0.566 4e-26
Q10209 392 Uncharacterized J domain- no no 0.766 0.484 0.311 1e-21
Q5L6F7 391 Chaperone protein DnaJ OS yes no 0.403 0.255 0.474 5e-18
Q823T2 392 Chaperone protein DnaJ OS yes no 0.274 0.173 0.632 2e-17
Q2S030 388 Chaperone protein DnaJ OS yes no 0.278 0.177 0.594 2e-16
P13830 1073 Ring-infected erythrocyte N/A no 0.766 0.177 0.303 2e-16
P13831 760 Ring-infected erythrocyte N/A no 0.766 0.25 0.303 3e-16
>sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 Back     alignment and function desciption
 Score =  290 bits (741), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 148/247 (59%), Positives = 187/247 (75%), Gaps = 7/247 (2%)

Query: 1   MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD 60
           MVK+T YYDVLGV+  A+ +EIKKAYY+KAR VHPDKNP DP+AA NFQVLGEAYQVLSD
Sbjct: 1   MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD 60

Query: 61  PEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEV--EEDKQ 118
             +R+AYD  GK GI  D+++D AA+F M+FGSE FE YIGQLA+A+MAS+++  E D+ 
Sbjct: 61  SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQF 120

Query: 119 DIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFG 178
           D +    KIQEK+R +QKERE+KL  ILK+ L  +V  + DEF+  A AE  RLS AA+G
Sbjct: 121 DTK----KIQEKLRIVQKEREDKLAQILKDRLNEYVINK-DEFISNAEAEVARLSNAAYG 175

Query: 179 EAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVR 238
             ML+TIGYIY R+AAKELGK   Y+ VPF+AEW R+KGH IKSQ++AA+G     +   
Sbjct: 176 VDMLNTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQE 235

Query: 239 EQRRELN 245
           E +R+LN
Sbjct: 236 EMKRQLN 242
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 Back     alignment and function description
>sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 Back     alignment and function description
>sp|P40564|DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DJP1 PE=1 SV=1 Back     alignment and function description
>sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 Back     alignment and function description
>sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain S26/3) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P13830|RESA_PLAFF Ring-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=RESA PE=2 SV=1 Back     alignment and function description
>sp|P13831|RESA_PLAFN Ring-infected erythrocyte surface antigen (Fragment) OS=Plasmodium falciparum (isolate NF7 / Ghana) GN=RESA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
255543767338 Chaperone protein dnaJ, putative [Ricinu 0.991 0.727 0.765 1e-113
363807528339 uncharacterized protein LOC100787075 [Gl 0.987 0.722 0.743 1e-106
356544152339 PREDICTED: chaperone protein dnaJ 10-lik 0.987 0.722 0.743 1e-105
388516395340 unknown [Lotus japonicus] 0.923 0.673 0.777 1e-104
297744425336 unnamed protein product [Vitis vinifera] 0.975 0.720 0.723 1e-102
357514923339 Chaperone protein dnaJ [Medicago truncat 0.987 0.722 0.719 1e-101
449464704339 PREDICTED: chaperone protein dnaJ 10-lik 0.987 0.722 0.723 1e-101
224105351339 predicted protein [Populus trichocarpa] 0.983 0.719 0.714 1e-100
115465213338 Os05g0543700 [Oryza sativa Japonica Grou 0.919 0.674 0.764 1e-98
224077866332 predicted protein [Populus trichocarpa] 0.955 0.713 0.714 3e-98
>gi|255543767|ref|XP_002512946.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223547957|gb|EEF49449.1| Chaperone protein dnaJ, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/247 (76%), Positives = 224/247 (90%), Gaps = 1/247 (0%)

Query: 1   MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD 60
           MVKDTAYY++LGVN+DASPA+IK+AYYLKAR+VHPDKNPGDPKAA+NFQ LGEAYQ+LSD
Sbjct: 1   MVKDTAYYEILGVNMDASPADIKRAYYLKARVVHPDKNPGDPKAAENFQKLGEAYQILSD 60

Query: 61  PEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDI 120
           PEKREAYDKHGKEGIPQDSM+D AAVFGM+FGSE+FEDYIGQLALAT++S+E+EED  D+
Sbjct: 61  PEKREAYDKHGKEGIPQDSMLDPAAVFGMLFGSEFFEDYIGQLALATLSSIEIEEDTPDV 120

Query: 121 EVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEA 180
           E+ K ++QEKMR MQKERE KL T+LKN LEPFV+G+ DEF+ WAN+EARRLS A+FGEA
Sbjct: 121 EIRKQRVQEKMREMQKEREGKLTTLLKNRLEPFVEGQVDEFINWANSEARRLSAASFGEA 180

Query: 181 MLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQ 240
           MLHTIGYIYTR+A++ELGKDKRYMKVPFLAEWVRDKGH IKSQV AASG     + ++E 
Sbjct: 181 MLHTIGYIYTRKASRELGKDKRYMKVPFLAEWVRDKGHQIKSQVMAASGAVSLIQ-IQED 239

Query: 241 RRELNES 247
            ++LN++
Sbjct: 240 LKKLNQT 246

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|363807528|ref|NP_001242400.1| uncharacterized protein LOC100787075 [Glycine max] gi|255642497|gb|ACU21512.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356544152|ref|XP_003540519.1| PREDICTED: chaperone protein dnaJ 10-like [Glycine max] Back     alignment and taxonomy information
>gi|388516395|gb|AFK46259.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297744425|emb|CBI37687.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357514923|ref|XP_003627750.1| Chaperone protein dnaJ [Medicago truncatula] gi|355521772|gb|AET02226.1| Chaperone protein dnaJ [Medicago truncatula] Back     alignment and taxonomy information
>gi|449464704|ref|XP_004150069.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus] gi|449523599|ref|XP_004168811.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224105351|ref|XP_002313780.1| predicted protein [Populus trichocarpa] gi|222850188|gb|EEE87735.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115465213|ref|NP_001056206.1| Os05g0543700 [Oryza sativa Japonica Group] gi|52353408|gb|AAU43976.1| putative DnaJ [Oryza sativa Japonica Group] gi|52353433|gb|AAU44001.1| putative DnaJ protein [Oryza sativa Japonica Group] gi|113579757|dbj|BAF18120.1| Os05g0543700 [Oryza sativa Japonica Group] gi|215678665|dbj|BAG92320.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737388|dbj|BAG96317.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|224077866|ref|XP_002305443.1| predicted protein [Populus trichocarpa] gi|118486373|gb|ABK95027.1| unknown [Populus trichocarpa] gi|222848407|gb|EEE85954.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2050120346 AT2G21510 [Arabidopsis thalian 0.987 0.708 0.695 1.3e-91
TAIR|locus:2136378345 AT4G39150 [Arabidopsis thalian 0.987 0.710 0.691 1.5e-90
TAIR|locus:2030101 398 AT1G76700 [Arabidopsis thalian 0.967 0.603 0.599 2.3e-71
TAIR|locus:2025252 379 AT1G77020 [Arabidopsis thalian 0.975 0.638 0.573 8.9e-70
CGD|CAL0003840 508 DJP1 [Candida albicans (taxid: 0.459 0.224 0.547 1e-35
UNIPROTKB|Q59NB9 508 DJP1 "Potential peroxisomal pr 0.459 0.224 0.547 1e-35
ASPGD|ASPL0000040613 466 AN3375 [Emericella nidulans (t 0.540 0.287 0.471 8.2e-35
SGD|S000000850 391 CAJ1 "Nuclear type II J heat s 0.423 0.268 0.547 2.1e-34
POMBASE|SPBC3E7.11c355 SPBC3E7.11c "DNAJ protein Caj1 0.774 0.540 0.394 5e-28
SGD|S000001443 432 DJP1 "Cytosolic J-domain-conta 0.536 0.307 0.489 1.2e-26
TAIR|locus:2050120 AT2G21510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 913 (326.5 bits), Expect = 1.3e-91, P = 1.3e-91
 Identities = 171/246 (69%), Positives = 209/246 (84%)

Query:     1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD 60
             MVK+T YY++LGV  DAS AEIKKAYYLKAR VHPDKNPGDP+AAKNFQVLGEAYQVLS+
Sbjct:     1 MVKETEYYEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSN 60

Query:    61 PEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDI 120
             P+KR AYDK+GKEG+ QD+MVD AAVFGM+FGSE FE+Y+GQLALA +AS+E + +  D 
Sbjct:    61 PDKRAAYDKYGKEGVQQDAMVDPAAVFGMLFGSEVFEEYVGQLALAYLASIEADLESHDP 120

Query:   121 EVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEA 180
             E+ K  +Q+K++A+QKERE+KL   LKN LEPFV+ + DEF++WAN EA+RLS A FGEA
Sbjct:   121 EIRKQMLQDKIKALQKEREDKLAATLKNKLEPFVERQTDEFIEWANEEAKRLSSAGFGEA 180

Query:   181 MLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQ 240
             M+HTIGYIYTR+AAKE+GKDKRYMKVPFLAEWVRDKGH +KSQV AASG     + ++++
Sbjct:   181 MMHTIGYIYTRKAAKEIGKDKRYMKVPFLAEWVRDKGHHMKSQVMAASGAVSLLQ-LQDE 239

Query:   241 RRELNE 246
               +LNE
Sbjct:   240 VNKLNE 245
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2136378 AT4G39150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030101 AT1G76700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025252 AT1G77020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003840 DJP1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59NB9 DJP1 "Potential peroxisomal protein import protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ASPGD|ASPL0000040613 AN3375 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000000850 CAJ1 "Nuclear type II J heat shock protein of the E. coli dnaJ family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPBC3E7.11c SPBC3E7.11c "DNAJ protein Caj1/Djp1-type (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000001443 DJP1 "Cytosolic J-domain-containing protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036336001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (336 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00017185001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (482 aa)
  •     0.484
GSVIVG00022013001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (667 aa)
  •     0.483
GSVIVG00018481001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (650 aa)
  •     0.483
GSVIVG00017724001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (538 aa)
  •     0.483
GSVIVG00037232001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (658 aa)
  •     0.481
GSVIVG00024357001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (652 aa)
  •     0.481
GSVIVG00021301001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (649 aa)
  •     0.481
GSVIVG00024351001
SubName- Full=Putative uncharacterized protein (Chromosome chr6 scaffold_3, whole genome shotgu [...] (648 aa)
  •     0.480
GSVIVG00022731001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (655 aa)
  •     0.480
GSVIVG00018506001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (649 aa)
  •     0.480

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
pfam14308204 pfam14308, DnaJ-X, X-domain of DnaJ-containing 9e-35
pfam0022663 pfam00226, DnaJ, DnaJ domain 7e-27
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 7e-27
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-26
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 7e-24
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 8e-24
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-21
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-21
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 8e-21
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-20
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-20
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-19
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-19
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 8e-19
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-18
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 1e-18
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 4e-18
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 6e-18
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-17
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-17
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 4e-17
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-16
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-16
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 4e-16
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 6e-16
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 6e-16
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 7e-16
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-15
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 6e-15
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-14
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-14
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-12
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-11
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-11
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-11
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 5e-10
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-07
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-04
PTZ00475 282 PTZ00475, PTZ00475, RESA-like protein; Provisional 5e-04
>gnl|CDD|222667 pfam14308, DnaJ-X, X-domain of DnaJ-containing Back     alignment and domain information 
 Score =  123 bits (310), Expect = 9e-35
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 133 AMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRR 192
             QKEREE+L   L++ L P+V+G  DEF +    EA  L   +FG  +LHTIG++Y  +
Sbjct: 1   EEQKEREEELAEKLRDRLSPYVEGDKDEFREKLEQEAEDLKMESFGLEILHTIGWVYENK 60

Query: 193 AAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQRRELNES 247
           A   LGK K ++ +  +   V+DKG  +KS  +  S  A +A+   E+ ++L E 
Sbjct: 61  ANSFLGKKKTFLGISGIFTSVKDKGRSVKSTFNTLSS-ALDAQSTMEEMKKLEEK 114

IN certain plant and yeast proteins, the DnaJ-1 proteins have a three-domain structure. The x-domain lies between the N-terminal DnaJ and the C-terminal Z domains. The exact function is not known. Length = 204
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|185654 PTZ00475, PTZ00475, RESA-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 100.0
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PF14308204 DnaJ-X: X-domain of DnaJ-containing 99.96
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
PTZ00475 282 RESA-like protein; Provisional 99.94
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.93
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
PRK14288 369 chaperone protein DnaJ; Provisional 99.89
PRK14296 372 chaperone protein DnaJ; Provisional 99.87
PRK14286 372 chaperone protein DnaJ; Provisional 99.87
PRK14282 369 chaperone protein DnaJ; Provisional 99.86
PRK14277 386 chaperone protein DnaJ; Provisional 99.86
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.86
PRK14279 392 chaperone protein DnaJ; Provisional 99.85
PRK14298 377 chaperone protein DnaJ; Provisional 99.85
PRK14285 365 chaperone protein DnaJ; Provisional 99.85
PRK14287 371 chaperone protein DnaJ; Provisional 99.85
PRK14276 380 chaperone protein DnaJ; Provisional 99.85
PRK14297 380 chaperone protein DnaJ; Provisional 99.85
PRK14294 366 chaperone protein DnaJ; Provisional 99.85
PRK14284 391 chaperone protein DnaJ; Provisional 99.84
PRK14301 373 chaperone protein DnaJ; Provisional 99.84
PRK14299291 chaperone protein DnaJ; Provisional 99.84
PRK14278 378 chaperone protein DnaJ; Provisional 99.83
PRK14283 378 chaperone protein DnaJ; Provisional 99.83
PRK14295 389 chaperone protein DnaJ; Provisional 99.83
PRK10767 371 chaperone protein DnaJ; Provisional 99.83
PRK14280 376 chaperone protein DnaJ; Provisional 99.83
PRK14291 382 chaperone protein DnaJ; Provisional 99.82
PHA03102153 Small T antigen; Reviewed 99.82
PRK14290 365 chaperone protein DnaJ; Provisional 99.82
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
PRK14281 397 chaperone protein DnaJ; Provisional 99.81
PRK14289 386 chaperone protein DnaJ; Provisional 99.81
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.8
PRK14292 371 chaperone protein DnaJ; Provisional 99.8
PRK14300 372 chaperone protein DnaJ; Provisional 99.79
PRK14293 374 chaperone protein DnaJ; Provisional 99.78
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.77
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.77
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.7
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.68
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.67
PRK00294173 hscB co-chaperone HscB; Provisional 99.66
PRK05014171 hscB co-chaperone HscB; Provisional 99.66
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.65
PRK03578176 hscB co-chaperone HscB; Provisional 99.64
PRK01356166 hscB co-chaperone HscB; Provisional 99.57
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.52
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.43
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.42
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
PRK01773173 hscB co-chaperone HscB; Provisional 99.39
PHA02624 647 large T antigen; Provisional 99.28
PTZ00100116 DnaJ chaperone protein; Provisional 99.28
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.26
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.22
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.16
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.05
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.98
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.42
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.23
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.93
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.92
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.59
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.02
KOG0431453 consensus Auxilin-like protein and related protein 95.81
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.24
PF1344662 RPT: A repeated domain in UCH-protein 83.12
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.8e-53  Score=419.45  Aligned_cols=236  Identities=25%  Similarity=0.416  Sum_probs=216.3

Q ss_pred             CCCCCccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHcCCHhHHHHHhhcCCCCCCCCCc
Q 025799            1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSM   80 (248)
Q Consensus         1 mv~~~~yY~iLgV~~~as~~eIkkaYrkla~k~HPDkn~~~~~a~~~f~~I~eAY~vLsdp~~R~~YD~~G~~~~~~~~~   80 (248)
                      |+++++||++|||+++||..+||+|||+||++||||++|++ .|.++|+.|++||+|||||.+|+.||+||..+++.+++
T Consensus       569 ~~~d~dYYdILGVs~dAS~~EIKKAYRKLAlkyHPDKN~~~-~A~ekFq~I~EAYeVLSDp~kRk~YD~~G~~Gl~~~~~  647 (1136)
T PTZ00341        569 EIPDTLFYDILGVGVNADMKEISERYFKLAENYYPPKRSGN-EGFHKFKKINEAYQILGDIDKKKMYNKFGYDGIKGVNF  647 (1136)
T ss_pred             cCCCCChHHHcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc-hHHHHHHHHHHHHHHhCCHHHHHHHhhccccccCCCCc
Confidence            67899999999999999999999999999999999999865 68889999999999999999999999999999988899


Q ss_pred             chhhhhhhhccccchHHHHhhHHHHHHhhhhhhhh--chhhHHHhhHHHHHHHHHHHHHHHHHHHHHHHhcccccccCCh
Q 025799           81 VDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEE--DKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRA  158 (248)
Q Consensus        81 ~d~~~~f~~~fg~~~f~~~~g~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~k~R~~~La~~L~~rl~~~v~g~~  158 (248)
                      +||..|| ++||++.|.+|+|.+.+++++...++.  ...+.+.....+++.+++.|++|+++||..|++||++||+|+.
T Consensus       648 iDP~~Ff-mlFgse~F~dYiG~l~iatl~k~~fe~~~s~~d~~~~~e~l~e~m~~~QkeRE~kLA~~LkdRL~~YVdgd~  726 (1136)
T PTZ00341        648 IHPSIFY-LLASLEKFADFTGSPQIVTLLKFFFEKKLSMNDLDNKSEHLLKFMEQYQKEREAHISENLINILQPCIAGDR  726 (1136)
T ss_pred             cCHHHHH-HHhhhHHHHHhcCCHHHHHHHHHHHHhcccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccH
Confidence            9999877 789999999999999999887665443  2234444567788999999999999999999999999999985


Q ss_pred             HHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHHHhccCCcccchhhhhHHHhhhhhhHHHHHHHHHHHH-HHHHHH
Q 025799          159 DEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRA-EEAEPV  237 (248)
Q Consensus       159 ~~f~~~~~~E~~~L~~~sfg~~iL~~IG~~Y~~~A~~~l~~~~~~~g~~~~~~~~~~k~~~~k~~~~~~~~a~-~~~~~~  237 (248)
                       .|...+..||+.|+.+|||..|||+|||||.++|+.||+++++  |+++++.+++.++.+++++++++++|+ ++|.++
T Consensus       727 -~w~~~~e~Ei~~L~~sSFG~~IL~tIGwiY~n~A~~fL~~~k~--g~~kl~~r~k~n~~~v~~~~n~lss~lkda~~t~  803 (1136)
T PTZ00341        727 -KWDVPIIDKIEELKGSPFDIAIIDSIGWIFKHVAKSHLKKPKK--AAKKLEQRSKANKEELANENNKLMNILKEYFGNN  803 (1136)
T ss_pred             -HHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHhccch--hHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhH
Confidence             5999999999999999999999999999999999999999987  778999999999999999999999999 888888


Q ss_pred             HHHH
Q 025799          238 REQR  241 (248)
Q Consensus       238 ~~~~  241 (248)
                      +.+.
T Consensus       804 eq~n  807 (1136)
T PTZ00341        804 EQIN  807 (1136)
T ss_pred             HHHH
Confidence            8875

>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14308 DnaJ-X: X-domain of DnaJ-containing Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00475 RESA-like protein; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-14
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-13
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 6e-13
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 6e-13
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 7e-13
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-12
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 4e-12
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 5e-12
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 7e-12
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-12
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-11
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 5e-11
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-10
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-10
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 8e-10
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-09
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 8e-09
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-08
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 6e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 6e-05
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-04
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 51/73 (69%), Gaps = 3/73 (4%)
Query: 1  MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD 60
          MVK+T YYDVLGV  DAS  E+KKAY   A   HPDKN   P  A+ F+ + +AY+VLSD
Sbjct: 4  MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKN---PDGAEQFKQISQAYEVLSD 60
Query: 61 PEKREAYDKHGKE 73
           +KR+ YD+ G+E
Sbjct: 61 EKKRQIYDQGGEE 73
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-30
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-27
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-27
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-27
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-27
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 8e-27
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-26
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-26
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-26
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 5e-26
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 9e-26
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-25
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-25
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 7e-25
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-23
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 4e-23
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-23
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 6e-23
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 5e-22
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-21
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 4e-20
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 9e-20
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-19
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-17
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-14
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-13
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 4e-13
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 5e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-11
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-10
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 3e-07
2guz_A71 Mitochondrial import inner membrane translocase su 3e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
 Score =  109 bits (275), Expect = 7e-30
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 7   YYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREA 66
           +Y +LGV+  AS  EI++A+   A  +HPDKNP +P A  +F  +  AY+VL D + R+ 
Sbjct: 4   FYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKK 63

Query: 67  YDKHGKEGIPQ--DSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYK 124
           YDK+G++G+        ++ + +   FG    +  I  L      +     +   +  Y 
Sbjct: 64  YDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYS 123
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.87
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.87
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.87
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.86
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.85
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.85
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.84
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.84
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.83
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.83
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.83
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.83
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.83
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.82
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.82
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.81
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.77
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.77
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.76
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.75
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.74
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.72
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.7
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.7
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.68
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.66
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.65
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.65
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.63
2guz_A71 Mitochondrial import inner membrane translocase su 99.58
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.08
2guz_B65 Mitochondrial import inner membrane translocase su 98.74
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
Probab=99.88  E-value=9.5e-23  Score=147.90  Aligned_cols=70  Identities=57%  Similarity=0.888  Sum_probs=63.2

Q ss_pred             CCCCCccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHcCCHhHHHHHhhcCCC
Q 025799            1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKE   73 (248)
Q Consensus         1 mv~~~~yY~iLgV~~~as~~eIkkaYrkla~k~HPDkn~~~~~a~~~f~~I~eAY~vLsdp~~R~~YD~~G~~   73 (248)
                      |+.+.+||+||||+++++..+||+|||++++++|||++++.   .+.|+.|++||++|+||.+|..||++|.+
T Consensus         4 m~~~~~~y~iLgl~~~a~~~eIk~ayr~l~~~~HPD~~~~~---~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~   73 (73)
T 2och_A            4 MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDG---AEQFKQISQAYEVLSDEKKRQIYDQGGEE   73 (73)
T ss_dssp             --CCCCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCTTC---HHHHHHHHHHHHHHTSHHHHHHHHHTC--
T ss_pred             ccCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCcCH---HHHHHHHHHHHHHHCCHHHHHHHHhcCCC
Confidence            78899999999999999999999999999999999999753   57899999999999999999999999963
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 3e-19
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-17
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-17
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-15
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 6e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-11
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-10
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 77.4 bits (190), Expect = 3e-19
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 7  YYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREA 66
          YY++LGV+  A   EI+KAY   A   HPD+N GD +A   F+ + EAY+VL+D +KR A
Sbjct: 5  YYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 64

Query: 67 YDKHGKEGIPQ 77
          YD++G     Q
Sbjct: 65 YDQYGHAAFEQ 75
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.92
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.83
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.82
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.73
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.71
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.65
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.62
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.92  E-value=2.4e-25  Score=161.43  Aligned_cols=73  Identities=44%  Similarity=0.732  Sum_probs=69.2

Q ss_pred             CCccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHcCCHhHHHHHhhcCCCCCC
Q 025799            4 DTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIP   76 (248)
Q Consensus         4 ~~~yY~iLgV~~~as~~eIkkaYrkla~k~HPDkn~~~~~a~~~f~~I~eAY~vLsdp~~R~~YD~~G~~~~~   76 (248)
                      ..|||+||||+++||.++||+|||++++++|||++++++.+...|+.|++||+||+||.+|..||++|..++.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e   74 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE   74 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence            4799999999999999999999999999999999998888899999999999999999999999999987653
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure