Citrus Sinensis ID: 025799
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| 255543767 | 338 | Chaperone protein dnaJ, putative [Ricinu | 0.991 | 0.727 | 0.765 | 1e-113 | |
| 363807528 | 339 | uncharacterized protein LOC100787075 [Gl | 0.987 | 0.722 | 0.743 | 1e-106 | |
| 356544152 | 339 | PREDICTED: chaperone protein dnaJ 10-lik | 0.987 | 0.722 | 0.743 | 1e-105 | |
| 388516395 | 340 | unknown [Lotus japonicus] | 0.923 | 0.673 | 0.777 | 1e-104 | |
| 297744425 | 336 | unnamed protein product [Vitis vinifera] | 0.975 | 0.720 | 0.723 | 1e-102 | |
| 357514923 | 339 | Chaperone protein dnaJ [Medicago truncat | 0.987 | 0.722 | 0.719 | 1e-101 | |
| 449464704 | 339 | PREDICTED: chaperone protein dnaJ 10-lik | 0.987 | 0.722 | 0.723 | 1e-101 | |
| 224105351 | 339 | predicted protein [Populus trichocarpa] | 0.983 | 0.719 | 0.714 | 1e-100 | |
| 115465213 | 338 | Os05g0543700 [Oryza sativa Japonica Grou | 0.919 | 0.674 | 0.764 | 1e-98 | |
| 224077866 | 332 | predicted protein [Populus trichocarpa] | 0.955 | 0.713 | 0.714 | 3e-98 |
| >gi|255543767|ref|XP_002512946.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223547957|gb|EEF49449.1| Chaperone protein dnaJ, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 412 bits (1058), Expect = e-113, Method: Compositional matrix adjust.
Identities = 189/247 (76%), Positives = 224/247 (90%), Gaps = 1/247 (0%)
Query: 1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD 60
MVKDTAYY++LGVN+DASPA+IK+AYYLKAR+VHPDKNPGDPKAA+NFQ LGEAYQ+LSD
Sbjct: 1 MVKDTAYYEILGVNMDASPADIKRAYYLKARVVHPDKNPGDPKAAENFQKLGEAYQILSD 60
Query: 61 PEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDI 120
PEKREAYDKHGKEGIPQDSM+D AAVFGM+FGSE+FEDYIGQLALAT++S+E+EED D+
Sbjct: 61 PEKREAYDKHGKEGIPQDSMLDPAAVFGMLFGSEFFEDYIGQLALATLSSIEIEEDTPDV 120
Query: 121 EVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEA 180
E+ K ++QEKMR MQKERE KL T+LKN LEPFV+G+ DEF+ WAN+EARRLS A+FGEA
Sbjct: 121 EIRKQRVQEKMREMQKEREGKLTTLLKNRLEPFVEGQVDEFINWANSEARRLSAASFGEA 180
Query: 181 MLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQ 240
MLHTIGYIYTR+A++ELGKDKRYMKVPFLAEWVRDKGH IKSQV AASG + ++E
Sbjct: 181 MLHTIGYIYTRKASRELGKDKRYMKVPFLAEWVRDKGHQIKSQVMAASGAVSLIQ-IQED 239
Query: 241 RRELNES 247
++LN++
Sbjct: 240 LKKLNQT 246
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|363807528|ref|NP_001242400.1| uncharacterized protein LOC100787075 [Glycine max] gi|255642497|gb|ACU21512.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356544152|ref|XP_003540519.1| PREDICTED: chaperone protein dnaJ 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388516395|gb|AFK46259.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|297744425|emb|CBI37687.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357514923|ref|XP_003627750.1| Chaperone protein dnaJ [Medicago truncatula] gi|355521772|gb|AET02226.1| Chaperone protein dnaJ [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449464704|ref|XP_004150069.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus] gi|449523599|ref|XP_004168811.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224105351|ref|XP_002313780.1| predicted protein [Populus trichocarpa] gi|222850188|gb|EEE87735.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|115465213|ref|NP_001056206.1| Os05g0543700 [Oryza sativa Japonica Group] gi|52353408|gb|AAU43976.1| putative DnaJ [Oryza sativa Japonica Group] gi|52353433|gb|AAU44001.1| putative DnaJ protein [Oryza sativa Japonica Group] gi|113579757|dbj|BAF18120.1| Os05g0543700 [Oryza sativa Japonica Group] gi|215678665|dbj|BAG92320.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737388|dbj|BAG96317.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|224077866|ref|XP_002305443.1| predicted protein [Populus trichocarpa] gi|118486373|gb|ABK95027.1| unknown [Populus trichocarpa] gi|222848407|gb|EEE85954.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| TAIR|locus:2050120 | 346 | AT2G21510 [Arabidopsis thalian | 0.987 | 0.708 | 0.695 | 1.3e-91 | |
| TAIR|locus:2136378 | 345 | AT4G39150 [Arabidopsis thalian | 0.987 | 0.710 | 0.691 | 1.5e-90 | |
| TAIR|locus:2030101 | 398 | AT1G76700 [Arabidopsis thalian | 0.967 | 0.603 | 0.599 | 2.3e-71 | |
| TAIR|locus:2025252 | 379 | AT1G77020 [Arabidopsis thalian | 0.975 | 0.638 | 0.573 | 8.9e-70 | |
| CGD|CAL0003840 | 508 | DJP1 [Candida albicans (taxid: | 0.459 | 0.224 | 0.547 | 1e-35 | |
| UNIPROTKB|Q59NB9 | 508 | DJP1 "Potential peroxisomal pr | 0.459 | 0.224 | 0.547 | 1e-35 | |
| ASPGD|ASPL0000040613 | 466 | AN3375 [Emericella nidulans (t | 0.540 | 0.287 | 0.471 | 8.2e-35 | |
| SGD|S000000850 | 391 | CAJ1 "Nuclear type II J heat s | 0.423 | 0.268 | 0.547 | 2.1e-34 | |
| POMBASE|SPBC3E7.11c | 355 | SPBC3E7.11c "DNAJ protein Caj1 | 0.774 | 0.540 | 0.394 | 5e-28 | |
| SGD|S000001443 | 432 | DJP1 "Cytosolic J-domain-conta | 0.536 | 0.307 | 0.489 | 1.2e-26 |
| TAIR|locus:2050120 AT2G21510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 913 (326.5 bits), Expect = 1.3e-91, P = 1.3e-91
Identities = 171/246 (69%), Positives = 209/246 (84%)
Query: 1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD 60
MVK+T YY++LGV DAS AEIKKAYYLKAR VHPDKNPGDP+AAKNFQVLGEAYQVLS+
Sbjct: 1 MVKETEYYEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSN 60
Query: 61 PEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDI 120
P+KR AYDK+GKEG+ QD+MVD AAVFGM+FGSE FE+Y+GQLALA +AS+E + + D
Sbjct: 61 PDKRAAYDKYGKEGVQQDAMVDPAAVFGMLFGSEVFEEYVGQLALAYLASIEADLESHDP 120
Query: 121 EVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEA 180
E+ K +Q+K++A+QKERE+KL LKN LEPFV+ + DEF++WAN EA+RLS A FGEA
Sbjct: 121 EIRKQMLQDKIKALQKEREDKLAATLKNKLEPFVERQTDEFIEWANEEAKRLSSAGFGEA 180
Query: 181 MLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQ 240
M+HTIGYIYTR+AAKE+GKDKRYMKVPFLAEWVRDKGH +KSQV AASG + ++++
Sbjct: 181 MMHTIGYIYTRKAAKEIGKDKRYMKVPFLAEWVRDKGHHMKSQVMAASGAVSLLQ-LQDE 239
Query: 241 RRELNE 246
+LNE
Sbjct: 240 VNKLNE 245
|
|
| TAIR|locus:2136378 AT4G39150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030101 AT1G76700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025252 AT1G77020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003840 DJP1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59NB9 DJP1 "Potential peroxisomal protein import protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000040613 AN3375 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000850 CAJ1 "Nuclear type II J heat shock protein of the E. coli dnaJ family" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC3E7.11c SPBC3E7.11c "DNAJ protein Caj1/Djp1-type (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| SGD|S000001443 DJP1 "Cytosolic J-domain-containing protein" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00036336001 | SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (336 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00017185001 | • | 0.484 | |||||||||
| GSVIVG00022013001 | • | 0.483 | |||||||||
| GSVIVG00018481001 | • | 0.483 | |||||||||
| GSVIVG00017724001 | • | 0.483 | |||||||||
| GSVIVG00037232001 | • | 0.481 | |||||||||
| GSVIVG00024357001 | • | 0.481 | |||||||||
| GSVIVG00021301001 | • | 0.481 | |||||||||
| GSVIVG00024351001 | • | 0.480 | |||||||||
| GSVIVG00022731001 | • | 0.480 | |||||||||
| GSVIVG00018506001 | • | 0.480 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| pfam14308 | 204 | pfam14308, DnaJ-X, X-domain of DnaJ-containing | 9e-35 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 7e-27 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 7e-27 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 3e-26 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 7e-24 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 8e-24 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 2e-21 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-21 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 3e-21 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 8e-21 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-20 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 2e-20 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 1e-19 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-19 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 8e-19 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-18 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 1e-18 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 4e-18 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 6e-18 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 1e-17 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 3e-17 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 4e-17 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-16 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 3e-16 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 4e-16 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 6e-16 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 6e-16 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 7e-16 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 2e-15 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 6e-15 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-14 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 3e-14 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 2e-12 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 1e-11 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 1e-11 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 2e-11 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 5e-10 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 1e-07 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 1e-04 | |
| PTZ00475 | 282 | PTZ00475, PTZ00475, RESA-like protein; Provisional | 5e-04 |
| >gnl|CDD|222667 pfam14308, DnaJ-X, X-domain of DnaJ-containing | Back alignment and domain information |
|---|
Score = 123 bits (310), Expect = 9e-35
Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 1/115 (0%)
Query: 133 AMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRR 192
QKEREE+L L++ L P+V+G DEF + EA L +FG +LHTIG++Y +
Sbjct: 1 EEQKEREEELAEKLRDRLSPYVEGDKDEFREKLEQEAEDLKMESFGLEILHTIGWVYENK 60
Query: 193 AAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRAEEAEPVREQRRELNES 247
A LGK K ++ + + V+DKG +KS + S A +A+ E+ ++L E
Sbjct: 61 ANSFLGKKKTFLGISGIFTSVKDKGRSVKSTFNTLSS-ALDAQSTMEEMKKLEEK 114
|
IN certain plant and yeast proteins, the DnaJ-1 proteins have a three-domain structure. The x-domain lies between the N-terminal DnaJ and the C-terminal Z domains. The exact function is not known. Length = 204 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|185654 PTZ00475, PTZ00475, RESA-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 100.0 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PF14308 | 204 | DnaJ-X: X-domain of DnaJ-containing | 99.96 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.95 | |
| PTZ00475 | 282 | RESA-like protein; Provisional | 99.94 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.93 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.89 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.89 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.87 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.87 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.86 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.86 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.82 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.82 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.82 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.81 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.81 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.8 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.78 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.77 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.77 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.77 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.77 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.7 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.69 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.68 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.67 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.66 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.66 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.65 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.64 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.57 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.52 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.47 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.43 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.42 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.41 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.39 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.28 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.28 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.26 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.22 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 99.16 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 99.05 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.98 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.42 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.23 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.93 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.92 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.59 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.02 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.81 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 93.24 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 83.12 |
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.8e-53 Score=419.45 Aligned_cols=236 Identities=25% Similarity=0.416 Sum_probs=216.3
Q ss_pred CCCCCccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHcCCHhHHHHHhhcCCCCCCCCCc
Q 025799 1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIPQDSM 80 (248)
Q Consensus 1 mv~~~~yY~iLgV~~~as~~eIkkaYrkla~k~HPDkn~~~~~a~~~f~~I~eAY~vLsdp~~R~~YD~~G~~~~~~~~~ 80 (248)
|+++++||++|||+++||..+||+|||+||++||||++|++ .|.++|+.|++||+|||||.+|+.||+||..+++.+++
T Consensus 569 ~~~d~dYYdILGVs~dAS~~EIKKAYRKLAlkyHPDKN~~~-~A~ekFq~I~EAYeVLSDp~kRk~YD~~G~~Gl~~~~~ 647 (1136)
T PTZ00341 569 EIPDTLFYDILGVGVNADMKEISERYFKLAENYYPPKRSGN-EGFHKFKKINEAYQILGDIDKKKMYNKFGYDGIKGVNF 647 (1136)
T ss_pred cCCCCChHHHcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc-hHHHHHHHHHHHHHHhCCHHHHHHHhhccccccCCCCc
Confidence 67899999999999999999999999999999999999865 68889999999999999999999999999999988899
Q ss_pred chhhhhhhhccccchHHHHhhHHHHHHhhhhhhhh--chhhHHHhhHHHHHHHHHHHHHHHHHHHHHHHhcccccccCCh
Q 025799 81 VDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEE--DKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRA 158 (248)
Q Consensus 81 ~d~~~~f~~~fg~~~f~~~~g~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~k~R~~~La~~L~~rl~~~v~g~~ 158 (248)
+||..|| ++||++.|.+|+|.+.+++++...++. ...+.+.....+++.+++.|++|+++||..|++||++||+|+.
T Consensus 648 iDP~~Ff-mlFgse~F~dYiG~l~iatl~k~~fe~~~s~~d~~~~~e~l~e~m~~~QkeRE~kLA~~LkdRL~~YVdgd~ 726 (1136)
T PTZ00341 648 IHPSIFY-LLASLEKFADFTGSPQIVTLLKFFFEKKLSMNDLDNKSEHLLKFMEQYQKEREAHISENLINILQPCIAGDR 726 (1136)
T ss_pred cCHHHHH-HHhhhHHHHHhcCCHHHHHHHHHHHHhcccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccH
Confidence 9999877 789999999999999999887665443 2234444567788999999999999999999999999999985
Q ss_pred HHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHHHhccCCcccchhhhhHHHhhhhhhHHHHHHHHHHHH-HHHHHH
Q 025799 159 DEFVKWANAEARRLSGAAFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGRA-EEAEPV 237 (248)
Q Consensus 159 ~~f~~~~~~E~~~L~~~sfg~~iL~~IG~~Y~~~A~~~l~~~~~~~g~~~~~~~~~~k~~~~k~~~~~~~~a~-~~~~~~ 237 (248)
.|...+..||+.|+.+|||..|||+|||||.++|+.||+++++ |+++++.+++.++.+++++++++++|+ ++|.++
T Consensus 727 -~w~~~~e~Ei~~L~~sSFG~~IL~tIGwiY~n~A~~fL~~~k~--g~~kl~~r~k~n~~~v~~~~n~lss~lkda~~t~ 803 (1136)
T PTZ00341 727 -KWDVPIIDKIEELKGSPFDIAIIDSIGWIFKHVAKSHLKKPKK--AAKKLEQRSKANKEELANENNKLMNILKEYFGNN 803 (1136)
T ss_pred -HHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHhccch--hHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhH
Confidence 5999999999999999999999999999999999999999987 778999999999999999999999999 888888
Q ss_pred HHHH
Q 025799 238 REQR 241 (248)
Q Consensus 238 ~~~~ 241 (248)
+.+.
T Consensus 804 eq~n 807 (1136)
T PTZ00341 804 EQIN 807 (1136)
T ss_pred HHHH
Confidence 8875
|
|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14308 DnaJ-X: X-domain of DnaJ-containing | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00475 RESA-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 248 | ||||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 3e-14 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 2e-13 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 6e-13 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 6e-13 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 7e-13 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 3e-12 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 4e-12 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 5e-12 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 7e-12 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 8e-12 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 1e-11 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 5e-11 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 1e-10 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-10 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 8e-10 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 3e-09 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 8e-09 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-08 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 6e-07 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 6e-05 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 4e-04 |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
|
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 7e-30 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 1e-27 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 1e-27 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-27 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 2e-27 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 8e-27 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-26 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 3e-26 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 4e-26 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 5e-26 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 9e-26 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-25 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 2e-25 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 7e-25 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 2e-23 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 4e-23 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 5e-23 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 6e-23 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 5e-22 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-21 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 4e-20 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 9e-20 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 4e-19 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 1e-17 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-14 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 1e-13 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-13 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 4e-13 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 5e-12 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 2e-11 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 1e-10 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 3e-07 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 3e-07 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
Score = 109 bits (275), Expect = 7e-30
Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 2/120 (1%)
Query: 7 YYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREA 66
+Y +LGV+ AS EI++A+ A +HPDKNP +P A +F + AY+VL D + R+
Sbjct: 4 FYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKK 63
Query: 67 YDKHGKEGIPQ--DSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDIEVYK 124
YDK+G++G+ ++ + + FG + I L + + + Y
Sbjct: 64 YDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYS 123
|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.88 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.87 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.87 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.87 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.86 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.86 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.85 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.85 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.85 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.84 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.84 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.83 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.83 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.83 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.83 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.83 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.82 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.82 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.81 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.77 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.77 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.76 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.75 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.74 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.72 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.7 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.7 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.68 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.66 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.65 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.65 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.63 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.58 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.08 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.74 |
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
Probab=99.88 E-value=9.5e-23 Score=147.90 Aligned_cols=70 Identities=57% Similarity=0.888 Sum_probs=63.2
Q ss_pred CCCCCccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHcCCHhHHHHHhhcCCC
Q 025799 1 MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKE 73 (248)
Q Consensus 1 mv~~~~yY~iLgV~~~as~~eIkkaYrkla~k~HPDkn~~~~~a~~~f~~I~eAY~vLsdp~~R~~YD~~G~~ 73 (248)
|+.+.+||+||||+++++..+||+|||++++++|||++++. .+.|+.|++||++|+||.+|..||++|.+
T Consensus 4 m~~~~~~y~iLgl~~~a~~~eIk~ayr~l~~~~HPD~~~~~---~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~ 73 (73)
T 2och_A 4 MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDG---AEQFKQISQAYEVLSDEKKRQIYDQGGEE 73 (73)
T ss_dssp --CCCCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCTTC---HHHHHHHHHHHHHHTSHHHHHHHHHTC--
T ss_pred ccCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCcCH---HHHHHHHHHHHHHHCCHHHHHHHHhcCCC
Confidence 78899999999999999999999999999999999999753 57899999999999999999999999963
|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 248 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 3e-19 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 2e-17 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 2e-17 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 3e-15 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 6e-14 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-12 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-11 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 2e-10 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 77.4 bits (190), Expect = 3e-19
Identities = 33/71 (46%), Positives = 46/71 (64%)
Query: 7 YYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREA 66
YY++LGV+ A EI+KAY A HPD+N GD +A F+ + EAY+VL+D +KR A
Sbjct: 5 YYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 64
Query: 67 YDKHGKEGIPQ 77
YD++G Q
Sbjct: 65 YDQYGHAAFEQ 75
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.92 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.83 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.82 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.73 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.71 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.65 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.62 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.92 E-value=2.4e-25 Score=161.43 Aligned_cols=73 Identities=44% Similarity=0.732 Sum_probs=69.2
Q ss_pred CCccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHcCCHhHHHHHhhcCCCCCC
Q 025799 4 DTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSDPEKREAYDKHGKEGIP 76 (248)
Q Consensus 4 ~~~yY~iLgV~~~as~~eIkkaYrkla~k~HPDkn~~~~~a~~~f~~I~eAY~vLsdp~~R~~YD~~G~~~~~ 76 (248)
..|||+||||+++||.++||+|||++++++|||++++++.+...|+.|++||+||+||.+|..||++|..++.
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e 74 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE 74 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence 4799999999999999999999999999999999998888899999999999999999999999999987653
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|