Citrus Sinensis ID: 025812


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLGFNQQPKIDLPIFQ
cEEEEEEccccHHHHHHHHHHcccEEEEEccccccccccEEEEccccHHHHHHHHHHcccHHHHHHHHHccccCECcHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccCECcccccccccccccEEEEEEcccEEEEccccCEEEEEECcccccccccccccEEEEEEEccEEEEECccccccccHHHHHHHHHHHHcccccccccccccccCEECccccccccccccccccccc
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMM********************************KIDLPIFQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLGFNQQPKIDLPIFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal biosynthesis protein PDX2 Involved in the production of pyridoxal (vitamin B6) and indirect resistance to singlet oxygen-generating photosensitizers.confidentQ8LAD0
Glutamine amidotransferase subunit PdxT Involved in the hydrolysis of glutamine to glutamate and ammonia. Channels an ammonia molecule to PdxS.probableA0LUK9
Glutamine amidotransferase subunit PdxT Involved in the hydrolysis of glutamine to glutamate and ammonia. Channels an ammonia molecule to PdxS.probableQ6AFB8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NV0, chain A
Confidence level:very confident
Coverage over the Query: 1-160,173-213
View the alignment between query and template
View the model in PyMOL
Template: 4GUD, chain A
Confidence level:very confident
Coverage over the Query: 2-206
View the alignment between query and template
View the model in PyMOL